Q9HME5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HME5 - Uncharacterized protein

UniProt:	Q9HME5	Sequences: MTELTVTDMSCAHCEQTVTDALTDLDGVTDATADADTDTVSYEGTADTDAVVAAIDDAGYTVAP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	64 (60)
Sequences:	6453 (4774)
Seq/√Len:	616.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_T	61_T	2.713	1.00
19_T	23_T	2.149	1.00
21_A	58_A	2.133	1.00
3_E	39_T	2.071	1.00
47_D	50_A	2.029	1.00
3_E	41_S	1.983	1.00
29_T	45_T	1.748	1.00
56_D	61_T	1.742	1.00
30_D	43_E	1.734	1.00
16_Q	20_D	1.674	1.00
22_L	40_V	1.668	1.00
9_M	18_V	1.661	1.00
11_C	14_C	1.634	1.00
6_V	9_M	1.563	1.00
6_V	40_V	1.551	1.00
25_L	54_A	1.529	1.00
15_E	35_A	1.469	1.00
29_T	43_E	1.372	1.00
52_V	62_V	1.356	1.00
53_A	57_D	1.314	1.00
17_T	58_A	1.286	1.00
21_A	54_A	1.280	1.00
44_G	47_D	1.153	1.00
21_A	25_L	1.119	1.00
12_A	36_D	1.102	1.00
10_S	17_T	1.084	1.00
5_T	62_V	1.047	1.00
55_I	61_T	1.046	1.00
33_A	40_V	1.037	1.00
48_T	52_V	1.037	1.00
22_L	31_A	1.013	1.00
50_A	53_A	1.006	1.00
42_Y	51_V	0.982	1.00
12_A	15_E	0.977	1.00
53_A	56_D	0.969	1.00
22_L	51_V	0.967	1.00
23_T	31_A	0.966	1.00
28_V	31_A	0.956	1.00
34_D	37_T	0.952	1.00
28_V	51_V	0.947	1.00
49_D	53_A	0.939	1.00
12_A	16_Q	0.893	1.00
8_D	61_T	0.879	1.00
13_H	16_Q	0.858	1.00
7_T	38_D	0.851	1.00
5_T	38_D	0.849	1.00
54_A	58_A	0.846	1.00
18_V	58_A	0.827	1.00
49_D	52_V	0.820	1.00
44_G	51_V	0.792	1.00
4_L	55_I	0.776	1.00
17_T	21_A	0.772	1.00
35_A	38_D	0.751	1.00
40_V	55_I	0.751	1.00
23_T	30_D	0.743	1.00
18_V	55_I	0.721	1.00
22_L	42_Y	0.701	1.00
8_D	55_I	0.701	1.00
19_T	32_T	0.696	1.00
4_L	62_V	0.687	1.00
31_A	35_A	0.686	1.00
4_L	40_V	0.684	1.00
13_H	17_T	0.674	1.00
4_L	52_V	0.673	1.00
4_L	48_T	0.665	1.00
13_H	36_D	0.661	1.00
9_M	33_A	0.657	1.00
5_T	41_S	0.652	1.00
4_L	51_V	0.652	1.00
15_E	19_T	0.649	1.00
32_T	43_E	0.649	1.00
40_V	51_V	0.645	1.00
52_V	56_D	0.635	1.00
15_E	33_A	0.617	1.00
54_A	57_D	0.615	1.00
40_V	62_V	0.605	1.00
17_T	60_Y	0.603	1.00
52_V	61_T	0.601	1.00
32_T	41_S	0.600	1.00
22_L	54_A	0.572	1.00
26_D	46_A	0.570	1.00
50_A	54_A	0.566	1.00
37_T	41_S	0.551	1.00
27_G	45_T	0.550	1.00
9_M	35_A	0.547	0.99
20_D	23_T	0.517	0.99
44_G	48_T	0.515	0.99
31_A	42_Y	0.513	0.99
19_T	33_A	0.505	0.99
13_H	35_A	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2roeA	1	1	99.4	0.224	Contact Map
2ropA	1	1	99.3	0.225	Contact Map
1p6tA	1	1	99.3	0.242	Contact Map
4umwA	1	0	99.3	0.244	Contact Map
2ew9A	1	1	99.3	0.249	Contact Map
1qupA	2	0.9844	99.3	0.255	Contact Map
3j09A	2	1	99.3	0.255	Contact Map
4u9rA	1	0.9375	99.3	0.258	Contact Map
2k2pA	1	0.9844	99.3	0.258	Contact Map
2ofgX	1	1	99.2	0.264	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.