SUI1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SUI1 - Protein translation factor SUI1 homolog

UniProt:	Q9HME3	Sequences: MSEVCSTCGLPEELCVCEDVAKESQQIEIRIDERRYGKEVTVIEGFDPKDVDLDSLSSDLKSKFACGGTVEDGEIELQGNHSGRVEDFLRNKGFNVA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	97 (84)
Sequences:	902 (575)
Seq/√Len:	62.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_D	92_K	4.447	1.00
30_R	44_E	3.239	1.00
36_Y	39_E	3.236	1.00
27_I	46_F	2.772	1.00
49_K	52_D	2.754	1.00
29_I	86_E	2.586	1.00
86_E	90_R	2.416	1.00
57_S	70_V	2.285	1.00
58_S	62_S	2.100	1.00
42_V	74_E	1.971	1.00
69_T	76_E	1.941	1.00
87_D	91_N	1.932	1.00
63_K	88_F	1.920	1.00
57_S	75_I	1.815	1.00
48_P	52_D	1.736	0.99
29_I	82_S	1.712	0.99
59_D	63_K	1.671	0.99
88_F	92_K	1.654	0.99
81_H	84_R	1.645	0.99
26_Q	95_N	1.587	0.99
87_D	90_R	1.567	0.99
63_K	84_R	1.499	0.98
34_R	39_E	1.455	0.98
50_D	54_D	1.434	0.98
55_S	59_D	1.433	0.98
88_F	91_N	1.384	0.97
45_G	69_T	1.314	0.96
59_D	88_F	1.292	0.96
83_G	87_D	1.248	0.95
19_D	49_K	1.217	0.94
41_T	85_V	1.199	0.94
39_E	82_S	1.170	0.93
41_T	79_G	1.117	0.91
30_R	42_V	1.108	0.91
34_R	76_E	1.104	0.91
34_R	40_V	1.061	0.89
66_C	81_H	1.059	0.89
58_S	66_C	1.057	0.89
84_R	88_F	1.034	0.88
64_F	77_L	1.012	0.86
38_K	58_S	0.928	0.81
13_E	18_E	0.926	0.81
16_V	19_D	0.925	0.81
56_L	85_V	0.914	0.80
43_I	85_V	0.898	0.79
63_K	91_N	0.892	0.79
27_I	48_P	0.881	0.78
31_I	34_R	0.854	0.76
70_V	76_E	0.814	0.72
77_L	85_V	0.808	0.71
62_S	85_V	0.799	0.71
37_G	64_F	0.795	0.70
25_Q	74_E	0.784	0.69
56_L	75_I	0.780	0.69
12_E	86_E	0.767	0.67
58_S	81_H	0.764	0.67
21_A	56_L	0.747	0.65
16_V	91_N	0.745	0.65
20_V	47_D	0.743	0.65
31_I	82_S	0.740	0.65
55_S	94_F	0.738	0.64
43_I	47_D	0.735	0.64
30_R	83_G	0.728	0.63
41_T	81_H	0.727	0.63
38_K	80_N	0.713	0.62
40_V	76_E	0.712	0.62
41_T	66_C	0.711	0.62
20_V	23_E	0.692	0.59
36_Y	65_A	0.679	0.58
41_T	64_F	0.671	0.57
81_H	85_V	0.671	0.57
13_E	17_C	0.669	0.57
15_C	18_E	0.667	0.57
46_F	52_D	0.659	0.56
29_I	42_V	0.658	0.56
32_D	41_T	0.656	0.55
38_K	72_D	0.652	0.55
76_E	81_H	0.647	0.54
42_V	76_E	0.645	0.54
64_F	84_R	0.636	0.53
25_Q	31_I	0.626	0.52
58_S	84_R	0.624	0.52
14_L	43_I	0.623	0.52
44_E	74_E	0.620	0.51
90_R	94_F	0.616	0.51
28_E	80_N	0.616	0.51
43_I	88_F	0.610	0.50
12_E	15_C	0.607	0.50
55_S	58_S	0.602	0.49
62_S	81_H	0.580	0.47
53_L	70_V	0.579	0.47
47_D	73_G	0.572	0.46
14_L	77_L	0.570	0.46
28_E	44_E	0.569	0.45
48_P	56_L	0.568	0.45
70_V	85_V	0.566	0.45
24_S	62_S	0.565	0.45
54_D	90_R	0.563	0.45
39_E	86_E	0.561	0.45
33_E	45_G	0.560	0.44
46_F	56_L	0.560	0.44
82_S	85_V	0.559	0.44
60_L	93_G	0.555	0.44
58_S	86_E	0.555	0.44
33_E	82_S	0.554	0.44
23_E	48_P	0.553	0.44
33_E	53_L	0.553	0.44
66_C	79_G	0.546	0.43
29_I	85_V	0.545	0.43
19_D	51_V	0.542	0.42
48_P	76_E	0.539	0.42
19_D	48_P	0.539	0.42
22_K	87_D	0.534	0.41
33_E	40_V	0.532	0.41
65_A	77_L	0.529	0.41
47_D	76_E	0.529	0.41
36_Y	61_K	0.523	0.40
21_A	51_V	0.522	0.40
49_K	91_N	0.517	0.40
86_E	91_N	0.515	0.39
35_R	42_V	0.514	0.39
86_E	95_N	0.513	0.39
28_E	34_R	0.511	0.39
31_I	80_N	0.506	0.38
29_I	81_H	0.504	0.38
62_S	66_C	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mo0A	1	0.7629	100	0.232	Contact Map
1d1rA	1	0.7835	99.9	0.37	Contact Map
2if1A	1	0.9897	99.8	0.458	Contact Map
4kzyl	1	0.7423	99.8	0.469	Contact Map
2oghA	1	0.9794	99.8	0.474	Contact Map
4bpeF	1	0.7835	99.8	0.476	Contact Map
4uerF	1	0.732	99.8	0.484	Contact Map
3j7yg	1	0.9485	99.8	0.504	Contact Map
1vw47	1	0.8351	99.1	0.678	Contact Map
2ausD	2	0.4021	26.9	0.919	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.