HIS2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS2 - Phosphoribosyl-ATP pyrophosphatase

UniProt:	Q9HMD4	Sequences: MSDPLRELFDVIEDRKETMPENSYTASLLADDEKGENAALEKVGEEATEFLLAAKDGDTDELAHEGADVVYHMLVVLAQQDMDVEALLAELDDRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	95 (88)
Sequences:	2234 (1229)
Seq/√Len:	131.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_T	71_Y	2.779	1.00
37_N	56_D	2.619	1.00
90_E	93_D	2.566	1.00
66_G	77_L	2.293	1.00
14_D	18_T	2.258	1.00
63_A	90_E	2.109	1.00
48_T	51_L	2.043	1.00
44_G	48_T	1.966	1.00
37_N	55_K	1.879	1.00
64_H	90_E	1.841	1.00
66_G	73_M	1.835	1.00
13_E	78_A	1.799	1.00
20_P	26_A	1.738	1.00
9_F	78_A	1.684	1.00
16_K	78_A	1.637	1.00
54_A	76_V	1.611	1.00
59_T	86_A	1.602	1.00
50_F	69_V	1.544	1.00
70_V	73_M	1.510	1.00
16_K	29_L	1.481	1.00
19_M	22_N	1.479	1.00
36_E	79_Q	1.392	1.00
12_I	29_L	1.384	1.00
39_A	76_V	1.343	1.00
9_F	84_V	1.335	1.00
12_I	74_L	1.328	1.00
19_M	26_A	1.325	1.00
9_F	13_E	1.283	1.00
43_V	69_V	1.272	1.00
66_G	70_V	1.236	1.00
36_E	80_Q	1.235	1.00
50_F	66_G	1.212	1.00
83_D	86_A	1.201	0.99
61_E	64_H	1.200	0.99
58_D	61_E	1.184	0.99
62_L	82_M	1.184	0.99
28_L	75_V	1.176	0.99
8_L	91_L	1.152	0.99
34_K	38_A	1.119	0.99
38_A	41_E	1.098	0.99
62_L	80_Q	1.098	0.99
53_A	61_E	1.059	0.99
39_A	79_Q	1.057	0.99
59_T	80_Q	1.045	0.99
41_E	48_T	1.030	0.98
59_T	82_M	1.021	0.98
57_G	80_Q	1.018	0.98
37_N	41_E	0.999	0.98
82_M	86_A	0.990	0.98
84_V	88_L	0.956	0.97
63_A	82_M	0.931	0.97
41_E	51_L	0.924	0.97
6_R	88_L	0.923	0.97
41_E	52_L	0.908	0.96
19_M	30_A	0.907	0.96
63_A	93_D	0.905	0.96
12_I	78_A	0.888	0.96
27_S	38_A	0.887	0.96
74_L	84_V	0.872	0.95
52_L	56_D	0.870	0.95
29_L	36_E	0.869	0.95
67_A	91_L	0.867	0.95
36_E	54_A	0.860	0.95
89_A	92_D	0.860	0.95
44_G	51_L	0.856	0.95
43_V	47_A	0.844	0.95
16_K	81_D	0.836	0.94
26_A	30_A	0.835	0.94
86_A	89_A	0.833	0.94
54_A	80_Q	0.833	0.94
30_A	34_K	0.830	0.94
40_L	55_K	0.825	0.94
10_D	83_D	0.821	0.94
35_G	39_A	0.819	0.94
47_A	51_L	0.816	0.94
50_F	62_L	0.810	0.93
5_L	74_L	0.807	0.93
18_T	22_N	0.805	0.93
7_E	10_D	0.800	0.93
85_E	88_L	0.800	0.93
50_F	76_V	0.798	0.93
14_D	17_E	0.782	0.92
50_F	73_M	0.776	0.92
67_A	87_L	0.769	0.91
13_E	83_D	0.767	0.91
27_S	30_A	0.759	0.91
29_L	78_A	0.722	0.89
40_L	43_V	0.705	0.87
53_A	62_L	0.689	0.86
9_F	83_D	0.689	0.86
38_A	61_E	0.686	0.86
29_L	79_Q	0.674	0.85
36_E	40_L	0.666	0.84
85_E	89_A	0.664	0.84
13_E	17_E	0.659	0.84
85_E	92_D	0.658	0.84
89_A	93_D	0.650	0.83
67_A	90_E	0.644	0.82
36_E	39_A	0.639	0.82
63_A	86_A	0.637	0.82
6_R	85_E	0.629	0.81
6_R	10_D	0.622	0.80
88_L	92_D	0.618	0.80
59_T	63_A	0.617	0.80
22_N	30_A	0.615	0.79
4_P	88_L	0.615	0.79
5_L	88_L	0.613	0.79
62_L	77_L	0.607	0.78
24_Y	27_S	0.602	0.78
13_E	16_K	0.588	0.76
43_V	48_T	0.586	0.76
38_A	52_L	0.582	0.76
16_K	26_A	0.580	0.75
60_D	64_H	0.573	0.74
48_T	52_L	0.572	0.74
11_V	14_D	0.567	0.74
37_N	51_L	0.559	0.73
40_L	48_T	0.557	0.72
24_Y	30_A	0.547	0.71
60_D	63_A	0.546	0.71
43_V	76_V	0.544	0.71
20_P	30_A	0.541	0.70
44_G	52_L	0.541	0.70
63_A	87_L	0.539	0.70
25_T	75_V	0.538	0.70
16_K	19_M	0.538	0.70
40_L	79_Q	0.537	0.70
36_E	55_K	0.522	0.67
55_K	61_E	0.512	0.66
71_Y	75_V	0.510	0.66
24_Y	53_A	0.508	0.65
14_D	22_N	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1yvwA	4	0.9368	100	0.127	Contact Map
2a7wA	4	0.9474	100	0.129	Contact Map
1y6xA	3	0.9158	100	0.169	Contact Map
1yxbA	4	0.8737	100	0.178	Contact Map
2yxhA	2	0.8737	99	0.685	Contact Map
2gtaA	4	0.8947	98.6	0.721	Contact Map
1vmgA	4	0.8632	98.2	0.753	Contact Map
2oieA	3	0.8842	97.2	0.8	Contact Map
2q73A	4	0.8316	96.6	0.816	Contact Map
2q5zA	4	0.8421	96.4	0.82	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.