Q9HMD3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HMD3 - Uncharacterized protein

UniProt:	Q9HMD3	Sequences: MNADIDAVRVADTPDGTIAVVVLARDDADDSGDVLPIFVGFEEAASIARGLDAVDIGRPLTHDVTLDLVEELGGRVDRVVISSVEAGTYFADLHVETPRGSTVVDARPSDSLALAARTNAPIAVADDVFAQGARSPDGFDELRDIREVMGDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (137)
Sequences:	1009 (701)
Seq/√Len:	59.9

HALSA - Q9HMD3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_G	43_E	3.998	1.00
76_V	93_L	3.981	1.00
92_D	103_V	2.884	1.00
65_T	68_L	2.874	1.00
5_I	124_V	2.780	1.00
21_V	112_L	2.705	1.00
106_A	111_S	2.688	1.00
65_T	114_L	2.550	1.00
4_D	26_D	2.454	1.00
77_D	96_E	2.350	1.00
69_V	74_G	2.335	1.00
7_A	116_A	2.214	1.00
74_G	95_V	2.190	1.00
128_V	132_G	1.971	1.00
66_L	118_T	1.929	1.00
20_V	38_F	1.899	1.00
68_L	104_V	1.881	1.00
47_I	113_A	1.848	1.00
97_T	100_G	1.789	0.99
113_A	117_R	1.787	0.99
96_E	99_R	1.714	0.99
82_S	92_D	1.702	0.99
13_T	38_F	1.631	0.99
75_R	96_E	1.600	0.99
35_L	129_F	1.600	0.99
89_Y	132_G	1.595	0.99
65_T	69_V	1.552	0.98
78_R	123_A	1.541	0.98
5_I	129_F	1.533	0.98
62_H	113_A	1.522	0.98
63_D	117_R	1.485	0.98
91_A	108_P	1.451	0.98
78_R	94_H	1.441	0.98
80_V	94_H	1.419	0.97
66_L	114_L	1.412	0.97
79_V	111_S	1.399	0.97
66_L	70_E	1.375	0.97
25_R	31_S	1.284	0.95
126_D	130_A	1.277	0.95
69_V	95_V	1.266	0.95
50_G	53_A	1.263	0.95
35_L	117_R	1.260	0.95
95_V	104_V	1.256	0.94
46_S	62_H	1.237	0.94
37_I	108_P	1.216	0.93
93_L	106_A	1.215	0.93
48_A	52_D	1.212	0.93
13_T	19_A	1.211	0.93
64_V	106_A	1.203	0.93
84_V	132_G	1.202	0.93
46_S	61_T	1.178	0.92
46_S	113_A	1.157	0.92
5_I	35_L	1.153	0.91
12_D	24_A	1.136	0.91
33_D	130_A	1.133	0.91
6_D	26_D	1.132	0.91
19_A	44_A	1.119	0.90
71_E	102_T	1.111	0.90
83_S	128_V	1.102	0.90
13_T	20_V	1.101	0.89
35_L	132_G	1.100	0.89
124_V	128_V	1.072	0.88
10_V	34_V	1.052	0.87
88_T	108_P	1.035	0.86
8_V	11_A	1.005	0.85
68_L	95_V	0.992	0.84
19_A	38_F	0.988	0.84
8_V	24_A	0.986	0.84
13_T	16_G	0.984	0.83
72_L	95_V	0.969	0.82
50_G	117_R	0.936	0.80
44_A	47_I	0.931	0.80
25_R	33_D	0.930	0.80
50_G	116_A	0.924	0.79
82_S	108_P	0.922	0.79
58_R	62_H	0.903	0.78
94_H	103_V	0.887	0.76
20_V	24_A	0.882	0.76
80_V	123_A	0.881	0.76
69_V	72_L	0.878	0.76
32_G	100_G	0.877	0.76
22_V	25_R	0.871	0.75
25_R	129_F	0.871	0.75
74_G	114_L	0.860	0.74
83_S	127_D	0.851	0.73
128_V	131_Q	0.851	0.73
47_I	63_D	0.845	0.73
74_G	96_E	0.839	0.72
88_T	124_V	0.838	0.72
89_Y	94_H	0.836	0.72
33_D	133_A	0.821	0.71
20_V	23_L	0.816	0.70
50_G	66_L	0.814	0.70
91_A	121_P	0.811	0.70
96_E	100_G	0.805	0.69
80_V	103_V	0.805	0.69
7_A	11_A	0.797	0.68
51_L	105_D	0.793	0.68
84_V	135_S	0.778	0.67
21_V	39_V	0.778	0.67
47_I	117_R	0.776	0.66
81_I	96_E	0.773	0.66
37_I	112_L	0.770	0.66
45_A	62_H	0.763	0.65
12_D	19_A	0.757	0.64
83_S	90_F	0.756	0.64
90_F	108_P	0.756	0.64
125_A	128_V	0.755	0.64
58_R	61_T	0.754	0.64
83_S	108_P	0.752	0.64
55_D	93_L	0.744	0.63
77_D	101_S	0.743	0.63
42_E	45_A	0.742	0.63
41_F	53_A	0.739	0.63
25_R	30_D	0.738	0.63
68_L	93_L	0.735	0.62
16_G	87_G	0.733	0.62
70_E	75_R	0.732	0.62
80_V	125_A	0.726	0.61
40_G	57_G	0.726	0.61
7_A	112_L	0.726	0.61
21_V	24_A	0.724	0.61
4_D	50_G	0.717	0.60
39_V	43_E	0.711	0.60
31_S	48_A	0.710	0.60
78_R	101_S	0.703	0.59
10_V	50_G	0.699	0.58
35_L	124_V	0.699	0.58
9_R	19_A	0.697	0.58
140_D	143_R	0.689	0.57
16_G	124_V	0.687	0.57
59_P	107_R	0.684	0.57
11_A	14_P	0.683	0.57
17_T	48_A	0.682	0.56
39_V	82_S	0.680	0.56
13_T	18_I	0.677	0.56
4_D	121_P	0.676	0.56
42_E	49_R	0.674	0.56
16_G	20_V	0.673	0.55
52_D	117_R	0.672	0.55
79_V	122_I	0.672	0.55
39_V	119_N	0.667	0.55
22_V	53_A	0.664	0.54
41_F	57_G	0.664	0.54
53_A	73_G	0.664	0.54
112_L	116_A	0.663	0.54
50_G	54_V	0.660	0.54
7_A	25_R	0.659	0.54
97_T	102_T	0.655	0.53
16_G	65_T	0.650	0.53
7_A	37_I	0.648	0.53
105_D	121_P	0.647	0.53
34_V	108_P	0.647	0.53
46_S	60_L	0.646	0.52
40_G	44_A	0.646	0.52
65_T	74_G	0.645	0.52
68_L	82_S	0.643	0.52
43_E	107_R	0.640	0.52
74_G	97_T	0.638	0.52
21_V	87_G	0.635	0.51
75_R	102_T	0.635	0.51
71_E	104_V	0.634	0.51
11_A	34_V	0.616	0.49
98_P	101_S	0.616	0.49
19_A	24_A	0.612	0.49
4_D	133_A	0.610	0.48
83_S	131_Q	0.607	0.48
24_A	84_V	0.598	0.47
46_S	57_G	0.597	0.47
104_V	128_V	0.596	0.47
138_G	141_E	0.590	0.46
53_A	56_I	0.589	0.46
58_R	107_R	0.584	0.46
5_I	50_G	0.583	0.45
105_D	108_P	0.583	0.45
77_D	97_T	0.582	0.45
43_E	58_R	0.581	0.45
20_V	104_V	0.580	0.45
127_D	131_Q	0.579	0.45
61_T	84_V	0.571	0.44
7_A	10_V	0.560	0.43
63_D	113_A	0.559	0.43
7_A	13_T	0.557	0.43
133_A	136_P	0.557	0.43
71_E	100_G	0.555	0.42
71_E	98_P	0.552	0.42
30_D	55_D	0.548	0.42
51_L	116_A	0.544	0.41
42_E	66_L	0.542	0.41
61_T	64_V	0.540	0.41
30_D	142_L	0.540	0.41
82_S	105_D	0.537	0.40
67_D	104_V	0.535	0.40
45_A	52_D	0.534	0.40
67_D	105_D	0.532	0.40
75_R	119_N	0.532	0.40
17_T	38_F	0.532	0.40
135_S	143_R	0.532	0.40
14_P	89_Y	0.524	0.39
76_V	119_N	0.518	0.38
58_R	109_S	0.510	0.37
9_R	13_T	0.510	0.37
9_R	17_T	0.504	0.37
18_I	24_A	0.504	0.37
33_D	126_D	0.501	0.37
137_D	141_E	0.500	0.36

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vjlA	2	0.9342	100	0.18	Contact Map
4c26A	1	0.4211	9.6	0.948	Contact Map
4yslA	2	0.8026	6.4	0.951	Contact Map
1kyfA	1	0.8158	5.7	0.953	Contact Map
4jb1A	1	0.8026	3.8	0.957	Contact Map
3r2uA	4	0.7237	3.6	0.957	Contact Map
2i9zA	2	0.4276	3.5	0.957	Contact Map
1reqA	1	0.4868	2.6	0.96	Contact Map
1ewqA	2	0.8289	2.5	0.96	Contact Map
1q47A	2	0.5395	2.5	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.