AMZA - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AMZA - Archaemetzincin

UniProt:	Q9HMC3	Sequences: MRVDIVPVGDVPAHVKRQASSSLRSVYDCEVVVASEQDVPTAAYDEARSQYRAAEFIDTATRATSGDKTIAITPHDLFYRRRNYVFGLAYLDGRGCVVSTYRLQTSSDGGFSNRSSSDVFDDRVRKEVVHELGHTLGLEHCDNNRCAMNFSPTVREVDRKEENLCGSCQRTVF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (166)
Sequences:	349 (270)
Seq/√Len:	20.9

HALSA - AMZA
SULSO - AMZA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_L	99_S	3.828	1.00
53_A	88_L	3.409	1.00
70_I	128_V	3.126	1.00
83_N	151_S	2.805	0.99
100_T	124_V	2.669	0.99
131_E	134_H	2.538	0.98
123_R	158_D	2.530	0.98
134_H	148_M	2.501	0.98
78_F	84_Y	2.499	0.98
130_H	140_H	2.474	0.98
73_T	99_S	2.392	0.97
87_G	140_H	2.320	0.96
130_H	134_H	2.202	0.95
131_E	140_H	2.176	0.95
127_E	160_K	2.151	0.94
165_C	168_C	2.079	0.93
73_T	77_L	2.074	0.93
83_N	150_F	2.073	0.93
83_N	152_P	1.908	0.90
103_L	157_V	1.879	0.89
98_V	128_V	1.865	0.89
131_E	148_M	1.832	0.88
27_Y	133_G	1.813	0.87
134_H	140_H	1.783	0.86
23_L	169_Q	1.760	0.86
87_G	130_H	1.729	0.85
14_H	72_I	1.724	0.84
68_K	135_T	1.708	0.84
150_F	156_E	1.682	0.83
149_N	157_V	1.658	0.82
85_V	151_S	1.627	0.81
86_F	160_K	1.583	0.79
76_D	102_R	1.574	0.78
78_F	83_N	1.550	0.77
60_A	71_A	1.535	0.77
50_Q	76_D	1.496	0.75
143_N	149_N	1.493	0.74
91_L	135_T	1.483	0.74
158_D	168_C	1.467	0.73
29_C	77_L	1.459	0.73
86_F	152_P	1.435	0.71
22_S	26_V	1.434	0.71
138_L	168_C	1.419	0.71
87_G	131_E	1.398	0.69
141_C	148_M	1.392	0.69
53_A	86_F	1.373	0.68
85_V	89_A	1.326	0.65
6_V	71_A	1.303	0.64
83_N	153_T	1.285	0.63
82_R	152_P	1.271	0.62
31_V	61_T	1.268	0.62
24_R	30_E	1.265	0.61
134_H	141_C	1.260	0.61
50_Q	78_F	1.207	0.58
98_V	124_V	1.205	0.58
94_R	135_T	1.201	0.57
62_R	69_T	1.184	0.56
84_Y	108_D	1.179	0.56
130_H	148_M	1.165	0.55
60_A	69_T	1.149	0.54
98_V	103_L	1.135	0.53
138_L	148_M	1.126	0.52
136_L	157_V	1.115	0.52
89_A	109_G	1.110	0.51
106_S	109_G	1.097	0.50
133_G	158_D	1.084	0.50
51_Y	169_Q	1.080	0.49
141_C	146_C	1.074	0.49
134_H	138_L	1.071	0.49
50_Q	150_F	1.043	0.47
86_F	158_D	1.036	0.46
52_R	88_L	1.030	0.46
53_A	93_G	1.020	0.45
45_D	80_R	1.016	0.45
166_G	169_Q	1.010	0.45
129_V	164_L	1.008	0.45
68_K	93_G	1.002	0.44
72_I	128_V	0.981	0.43
11_V	72_I	0.975	0.42
128_V	149_N	0.970	0.42
40_P	97_V	0.970	0.42
50_Q	84_Y	0.968	0.42
131_E	138_L	0.967	0.42
34_A	64_T	0.967	0.42
48_R	103_L	0.962	0.42
85_V	158_D	0.958	0.41
148_M	165_C	0.958	0.41
4_D	65_S	0.955	0.41
78_F	152_P	0.941	0.40
114_R	117_S	0.940	0.40
138_L	154_V	0.927	0.39
77_L	154_V	0.923	0.39
73_T	97_V	0.922	0.39
85_V	96_C	0.920	0.39
110_G	115_S	0.919	0.39
132_L	162_E	0.914	0.39
103_L	127_E	0.913	0.39
48_R	133_G	0.912	0.38
144_N	149_N	0.911	0.38
121_D	125_R	0.910	0.38
80_R	83_N	0.907	0.38
82_R	86_F	0.906	0.38
82_R	96_C	0.902	0.38
105_T	110_G	0.896	0.37
50_Q	89_A	0.890	0.37
94_R	162_E	0.888	0.37
60_A	156_E	0.883	0.37
83_N	157_V	0.878	0.36
29_C	67_D	0.877	0.36
146_C	168_C	0.869	0.36
4_D	66_G	0.863	0.35
147_A	154_V	0.862	0.35
19_A	29_C	0.858	0.35
26_V	171_T	0.858	0.35
51_Y	171_T	0.851	0.35
68_K	136_L	0.850	0.35
74_P	132_L	0.850	0.35
141_C	165_C	0.844	0.34
110_G	116_S	0.844	0.34
46_E	122_D	0.844	0.34
89_A	140_H	0.840	0.34
140_H	165_C	0.839	0.34
28_D	74_P	0.838	0.34
56_F	115_S	0.835	0.34
74_P	94_R	0.831	0.33
19_A	98_V	0.828	0.33
87_G	134_H	0.816	0.33
134_H	165_C	0.814	0.32
44_Y	160_K	0.811	0.32
7_P	37_Q	0.810	0.32
136_L	159_R	0.809	0.32
28_D	164_L	0.804	0.32
50_Q	102_R	0.800	0.32
141_C	168_C	0.787	0.31
96_C	135_T	0.784	0.31
50_Q	156_E	0.783	0.31
157_V	160_K	0.783	0.31
76_D	84_Y	0.776	0.30
75_H	99_S	0.774	0.30
129_V	136_L	0.773	0.30
145_R	161_E	0.772	0.30
78_F	92_D	0.752	0.29
67_D	94_R	0.742	0.28
40_P	51_Y	0.738	0.28
79_Y	82_R	0.731	0.28
137_G	141_C	0.729	0.28
83_N	88_L	0.727	0.28
70_I	101_Y	0.726	0.28
70_I	98_V	0.719	0.27
47_A	136_L	0.716	0.27
6_V	34_A	0.716	0.27
93_G	135_T	0.715	0.27
145_R	166_G	0.715	0.27
63_A	96_C	0.710	0.27
133_G	147_A	0.706	0.27
127_E	135_T	0.705	0.26
99_S	102_R	0.704	0.26
23_L	67_D	0.693	0.26
6_V	27_Y	0.689	0.26
15_V	18_Q	0.689	0.26
98_V	157_V	0.689	0.26
94_R	132_L	0.682	0.25
57_I	170_R	0.680	0.25
120_F	164_L	0.679	0.25
48_R	127_E	0.678	0.25
138_L	147_A	0.677	0.25
119_V	122_D	0.676	0.25
146_C	165_C	0.676	0.25
12_P	16_K	0.666	0.25
18_Q	97_V	0.666	0.25
78_F	89_A	0.664	0.24
72_I	90_Y	0.664	0.24
147_A	157_V	0.662	0.24
35_S	38_D	0.662	0.24
48_R	158_D	0.660	0.24
19_A	27_Y	0.660	0.24
17_R	70_I	0.656	0.24
9_G	71_A	0.652	0.24
138_L	141_C	0.651	0.24
28_D	169_Q	0.651	0.24
20_S	58_D	0.649	0.24
77_L	97_V	0.648	0.24
57_I	90_Y	0.647	0.24
44_Y	103_L	0.647	0.24
8_V	163_N	0.647	0.24
27_Y	125_R	0.645	0.24
163_N	166_G	0.643	0.23
27_Y	164_L	0.639	0.23
23_L	129_V	0.638	0.23
166_G	171_T	0.637	0.23
6_V	9_G	0.636	0.23
103_L	140_H	0.624	0.23
29_C	37_Q	0.619	0.22
131_E	141_C	0.618	0.22
74_P	120_F	0.616	0.22
54_A	80_R	0.616	0.22
90_Y	156_E	0.615	0.22
11_V	92_D	0.611	0.22
27_Y	56_F	0.610	0.22
85_V	88_L	0.608	0.22
103_L	160_K	0.607	0.22
104_Q	107_S	0.603	0.22
79_Y	96_C	0.602	0.22
8_V	72_I	0.601	0.21
126_K	130_H	0.601	0.21
124_V	145_R	0.595	0.21
106_S	116_S	0.594	0.21
12_P	17_R	0.592	0.21
4_D	27_Y	0.592	0.21
100_T	162_E	0.590	0.21
36_E	97_V	0.590	0.21
120_F	124_V	0.579	0.21
127_E	130_H	0.578	0.20
79_Y	93_G	0.577	0.20
147_A	150_F	0.577	0.20
14_H	58_D	0.571	0.20
65_S	96_C	0.570	0.20
49_S	136_L	0.570	0.20
50_Q	77_L	0.567	0.20
133_G	140_H	0.565	0.20
17_R	97_V	0.563	0.20
45_D	126_K	0.561	0.20
149_N	161_E	0.559	0.20
68_K	132_L	0.557	0.20
84_Y	152_P	0.555	0.19
53_A	103_L	0.554	0.19
118_D	122_D	0.551	0.19
140_H	151_S	0.551	0.19
81_R	153_T	0.545	0.19
69_T	85_V	0.544	0.19
40_P	71_A	0.541	0.19
72_I	109_G	0.541	0.19
86_F	157_V	0.540	0.19
15_V	121_D	0.537	0.19
63_A	156_E	0.535	0.19
152_P	160_K	0.533	0.19
47_A	97_V	0.529	0.18
79_Y	100_T	0.528	0.18
11_V	30_E	0.525	0.18
82_R	88_L	0.519	0.18
84_Y	101_Y	0.519	0.18
30_E	154_V	0.514	0.18
9_G	38_D	0.511	0.18
123_R	133_G	0.510	0.18
54_A	88_L	0.510	0.18
27_Y	105_T	0.509	0.18
125_R	168_C	0.507	0.18
51_Y	155_R	0.502	0.17
41_T	126_K	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3lmcA	1	0.9769	100	0.383	Contact Map
3zvsA	1	0.9191	100	0.385	Contact Map
2x7mA	1	0.9364	100	0.469	Contact Map
1atlA	2	0.8671	98.2	0.844	Contact Map
2eroA	2	0.8671	98.2	0.844	Contact Map
4j4mA	1	0.8671	98.2	0.845	Contact Map
1kufA	1	0.8671	98.2	0.845	Contact Map
2e3xA	1	0.8671	98.1	0.846	Contact Map
1budA	1	0.8671	98.1	0.846	Contact Map
1r55A	1	0.8671	98.1	0.846	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0154 seconds.