Q9HM86 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HM86 - Uncharacterized protein

UniProt:	Q9HM86	Sequences: MEEYRSHAHSVSSCKYHFVWCPKYRHPVLNVVEDDVRELFSETADHFGHEILALEIADDHVHLFVQCDPKHSPADIARQFKSYSGKHLLERYPEIRESYFWGGGFWKVGYYVGTTGEVSEEVVERYIEQTEH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (125)
Sequences:	1486 (960)
Seq/√Len:	85.9

HALSA - Q9HM86 Q9HSW8 Q9HHX7 Q9HSD5
SULSO - Q97Y68

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_D	91_R	4.939	1.00
35_D	92_Y	3.113	1.00
39_L	84_S	2.585	1.00
16_Y	67_C	2.560	1.00
40_F	84_S	2.534	1.00
40_F	80_F	2.202	1.00
86_K	90_E	2.152	1.00
125_R	129_Q	2.006	1.00
53_A	128_E	2.003	1.00
87_H	90_E	1.955	1.00
49_H	76_I	1.923	1.00
120_E	124_E	1.878	1.00
37_R	41_S	1.804	1.00
35_D	38_E	1.801	1.00
67_C	73_P	1.786	1.00
35_D	39_L	1.757	1.00
64_F	127_I	1.608	1.00
5_R	50_E	1.574	1.00
18_F	77_A	1.553	1.00
47_F	79_Q	1.552	1.00
12_S	112_V	1.537	1.00
85_G	89_L	1.517	1.00
21_C	107_K	1.497	0.99
29_L	105_F	1.461	0.99
43_T	47_F	1.460	0.99
15_K	115_T	1.451	0.99
6_S	11_V	1.446	0.99
67_C	76_I	1.441	0.99
43_T	83_Y	1.441	0.99
44_A	80_F	1.415	0.99
93_P	96_R	1.401	0.99
16_Y	114_T	1.399	0.99
5_R	66_Q	1.376	0.99
89_L	103_G	1.354	0.99
75_D	78_R	1.339	0.99
50_E	66_Q	1.329	0.99
68_D	71_H	1.321	0.99
7_H	10_S	1.316	0.99
124_E	128_E	1.298	0.99
14_C	67_C	1.291	0.98
115_T	120_E	1.275	0.98
44_A	51_I	1.252	0.98
73_P	77_A	1.246	0.98
16_Y	73_P	1.232	0.98
125_R	128_E	1.231	0.98
18_F	73_P	1.231	0.98
7_H	12_S	1.229	0.98
85_G	103_G	1.205	0.98
65_V	76_I	1.200	0.98
48_G	70_K	1.197	0.97
18_F	65_V	1.172	0.97
16_Y	112_V	1.165	0.97
33_E	37_R	1.159	0.97
121_E	124_E	1.158	0.97
89_L	96_R	1.158	0.97
69_P	74_A	1.136	0.97
14_C	112_V	1.135	0.97
78_R	108_V	1.099	0.96
39_L	83_Y	1.093	0.96
29_L	88_L	1.079	0.95
39_L	87_H	1.076	0.95
40_F	61_V	1.052	0.95
106_W	110_Y	1.034	0.94
97_E	102_G	0.994	0.93
88_L	95_I	0.992	0.93
73_P	112_V	0.986	0.93
41_S	45_D	0.984	0.93
44_A	49_H	0.967	0.92
40_F	54_L	0.963	0.92
18_F	112_V	0.958	0.92
37_R	55_E	0.958	0.92
36_V	88_L	0.953	0.91
12_S	66_Q	0.945	0.91
65_V	112_V	0.935	0.90
32_V	94_E	0.934	0.90
100_F	104_G	0.925	0.90
15_K	66_Q	0.922	0.90
33_E	54_L	0.912	0.89
42_E	45_D	0.906	0.89
42_E	46_H	0.902	0.89
72_S	75_D	0.902	0.89
71_H	76_I	0.891	0.88
119_S	122_V	0.889	0.88
38_E	45_D	0.889	0.88
37_R	54_L	0.886	0.88
29_L	36_V	0.883	0.88
68_D	72_S	0.873	0.87
39_L	43_T	0.860	0.86
82_S	104_G	0.856	0.86
15_K	52_L	0.850	0.86
122_V	125_R	0.848	0.86
43_T	79_Q	0.843	0.85
113_G	119_S	0.831	0.84
32_V	95_I	0.822	0.84
31_V	35_D	0.818	0.84
64_F	120_E	0.818	0.84
14_C	73_P	0.803	0.82
79_Q	83_Y	0.783	0.81
10_S	14_C	0.783	0.81
44_A	76_I	0.782	0.81
49_H	71_H	0.780	0.81
40_F	63_L	0.776	0.80
68_D	74_A	0.774	0.80
14_C	114_T	0.774	0.80
35_D	88_L	0.771	0.80
13_S	113_G	0.770	0.80
85_G	104_G	0.759	0.79
100_F	103_G	0.759	0.79
12_S	16_Y	0.752	0.78
32_V	88_L	0.749	0.78
93_P	101_W	0.748	0.78
5_R	12_S	0.746	0.78
26_H	100_F	0.742	0.77
36_V	40_F	0.738	0.77
104_G	108_V	0.737	0.77
119_S	127_I	0.737	0.77
78_R	83_Y	0.736	0.77
41_S	51_I	0.735	0.76
57_A	130_T	0.735	0.76
74_A	110_Y	0.730	0.76
33_E	57_A	0.724	0.75
65_V	73_P	0.718	0.75
31_V	34_D	0.716	0.75
44_A	82_S	0.714	0.74
72_S	77_A	0.714	0.74
27_P	59_D	0.708	0.74
20_W	65_V	0.702	0.73
42_E	87_H	0.700	0.73
33_E	56_I	0.695	0.72
25_R	59_D	0.688	0.72
5_R	77_A	0.684	0.71
33_E	55_E	0.684	0.71
101_W	106_W	0.680	0.71
64_F	118_V	0.675	0.70
55_E	109_G	0.675	0.70
38_E	91_R	0.673	0.70
117_E	120_E	0.671	0.70
38_E	88_L	0.669	0.70
38_E	42_E	0.669	0.70
51_I	65_V	0.669	0.70
29_L	32_V	0.666	0.69
113_G	118_V	0.658	0.68
13_S	111_Y	0.658	0.68
83_Y	87_H	0.651	0.67
7_H	68_D	0.651	0.67
45_D	48_G	0.647	0.67
73_P	76_I	0.643	0.66
52_L	66_Q	0.635	0.66
56_I	61_V	0.626	0.64
64_F	115_T	0.626	0.64
72_S	114_T	0.625	0.64
127_I	130_T	0.624	0.64
27_P	58_D	0.620	0.64
89_L	104_G	0.615	0.63
26_H	98_S	0.607	0.62
95_I	103_G	0.606	0.62
118_V	122_V	0.605	0.62
44_A	63_L	0.604	0.62
96_R	103_G	0.592	0.60
43_T	87_H	0.592	0.60
97_E	101_W	0.591	0.60
76_I	80_F	0.591	0.60
39_L	91_R	0.589	0.60
111_Y	118_V	0.589	0.60
9_H	108_V	0.587	0.59
16_Y	68_D	0.587	0.59
34_D	95_I	0.585	0.59
32_V	96_R	0.580	0.59
46_H	83_Y	0.576	0.58
13_S	66_Q	0.570	0.57
103_G	107_K	0.568	0.57
71_H	75_D	0.567	0.57
21_C	55_E	0.567	0.57
53_A	64_F	0.557	0.56
27_P	69_P	0.555	0.55
38_E	41_S	0.534	0.52
31_V	94_E	0.532	0.52
22_P	56_I	0.526	0.51
121_E	125_R	0.523	0.51
88_L	91_R	0.518	0.50
37_R	56_I	0.516	0.50
47_F	82_S	0.511	0.49
67_C	114_T	0.510	0.49
9_H	109_G	0.506	0.49
82_S	89_L	0.505	0.49
26_H	127_I	0.500	0.48
83_Y	86_K	0.500	0.48
22_P	100_F	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vjvA	2	0.9318	100	0.375	Contact Map
2fyxA	2	0.9621	100	0.391	Contact Map
2f5gA	2	0.947	100	0.397	Contact Map
4er8A	1	0.8939	99.9	0.521	Contact Map
3l15A	1	0.6288	14.6	0.944	Contact Map
4re1A	1	0.5909	13.1	0.945	Contact Map
1ofdA	1	0.8485	9.8	0.948	Contact Map
1q2lA	1	0.8788	9.4	0.949	Contact Map
2ga1A	2	0.7045	8.8	0.949	Contact Map
3hlxA	2	0.3864	7.2	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0092 seconds.