Q9HI09 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HI09 - Vng6126h

UniProt:	Q9HI09	Sequences: MFRVSELQRMQDLTGFQRDLLYVIAGLDEPHGLAVKAEMEEYYTSEIHHGRLYPNLDTLVDKGLVEKGKLDQRTNSYALTRRGQREIAARREWEHQYVTLDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (89)
Sequences:	289 (131)
Seq/√Len:	13.9

HALSA - Q9HI09 O52006 Q9HHE2 Q9HRD2 Q9HPX7 Q9HSF4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_G	54_P	2.709	0.95
47_I	61_D	2.468	0.92
33_L	39_M	2.212	0.87
31_H	34_A	2.151	0.85
91_R	94_E	2.132	0.84
40_E	47_I	2.089	0.83
49_H	52_L	2.067	0.82
82_R	86_E	1.989	0.80
70_L	76_S	1.945	0.78
68_G	76_S	1.920	0.77
54_P	67_K	1.769	0.71
15_G	18_R	1.732	0.69
45_S	98_V	1.720	0.69
28_D	96_Q	1.719	0.69
62_K	85_R	1.717	0.69
30_P	76_S	1.635	0.65
90_R	94_E	1.626	0.64
82_R	85_R	1.555	0.61
24_I	37_A	1.531	0.60
10_M	93_W	1.500	0.58
24_I	79_L	1.497	0.58
14_T	83_G	1.475	0.57
15_G	19_D	1.471	0.56
54_P	83_G	1.448	0.55
26_G	30_P	1.431	0.54
14_T	51_R	1.419	0.54
38_E	50_G	1.401	0.53
12_D	43_Y	1.334	0.49
31_H	39_M	1.323	0.48
63_G	82_R	1.322	0.48
22_Y	90_R	1.309	0.48
47_I	82_R	1.300	0.47
50_G	67_K	1.291	0.47
13_L	17_Q	1.252	0.45
12_D	96_Q	1.218	0.43
42_Y	93_W	1.216	0.43
69_K	81_R	1.215	0.43
38_E	89_A	1.206	0.42
42_Y	80_T	1.184	0.41
44_T	57_D	1.175	0.40
19_D	90_R	1.159	0.40
83_G	88_A	1.146	0.39
67_K	93_W	1.121	0.38
54_P	58_T	1.119	0.38
24_I	65_V	1.106	0.37
31_H	70_L	1.102	0.37
65_V	84_Q	1.087	0.36
24_I	30_P	1.071	0.35
70_L	84_Q	1.051	0.34
87_I	95_H	1.045	0.34
57_D	83_G	1.024	0.33
14_T	17_Q	1.020	0.33
86_E	89_A	0.961	0.30
54_P	57_D	0.958	0.30
38_E	64_L	0.940	0.29
12_D	49_H	0.919	0.28
18_R	58_T	0.917	0.28
48_H	71_D	0.912	0.28
12_D	94_E	0.906	0.28
32_G	75_N	0.902	0.27
17_Q	36_K	0.898	0.27
16_F	73_R	0.889	0.27
25_A	35_V	0.871	0.26
43_Y	48_H	0.864	0.26
10_M	42_Y	0.862	0.26
67_K	90_R	0.860	0.26
13_L	40_E	0.842	0.25
62_K	97_Y	0.839	0.25
10_M	30_P	0.827	0.24
38_E	42_Y	0.826	0.24
11_Q	83_G	0.824	0.24
49_H	64_L	0.823	0.24
26_G	94_E	0.817	0.24
67_K	75_N	0.804	0.23
60_V	74_T	0.803	0.23
50_G	60_V	0.798	0.23
23_V	45_S	0.796	0.23
44_T	87_I	0.781	0.22
50_G	74_T	0.773	0.22
48_H	72_Q	0.755	0.22
20_L	46_E	0.743	0.21
50_G	75_N	0.728	0.21
89_A	94_E	0.722	0.20
49_H	71_D	0.715	0.20
43_Y	47_I	0.697	0.19
18_R	30_P	0.697	0.19
19_D	26_G	0.691	0.19
60_V	67_K	0.689	0.19
20_L	58_T	0.682	0.19
36_K	71_D	0.668	0.19
23_V	80_T	0.667	0.18
25_A	46_E	0.666	0.18
26_G	97_Y	0.656	0.18
44_T	48_H	0.655	0.18
15_G	30_P	0.652	0.18
63_G	79_L	0.649	0.18
60_V	92_E	0.638	0.18
29_E	33_L	0.637	0.18
65_V	78_A	0.637	0.18
46_E	82_R	0.627	0.17
32_G	73_R	0.620	0.17
69_K	72_Q	0.619	0.17
29_E	65_V	0.611	0.17
15_G	84_Q	0.602	0.16
44_T	89_A	0.591	0.16
26_G	93_W	0.590	0.16
29_E	76_S	0.589	0.16
67_K	72_Q	0.585	0.16
60_V	65_V	0.585	0.16
54_P	78_A	0.583	0.16
51_R	64_L	0.583	0.16
35_V	88_A	0.583	0.16
28_D	35_V	0.574	0.16
65_V	88_A	0.564	0.15
23_V	69_K	0.563	0.15
33_L	43_Y	0.563	0.15
29_E	79_L	0.548	0.15
47_I	68_G	0.545	0.15
30_P	87_I	0.545	0.15
56_L	74_T	0.544	0.15
40_E	58_T	0.541	0.15
52_L	64_L	0.525	0.14
27_L	31_H	0.525	0.14
58_T	62_K	0.524	0.14
32_G	77_Y	0.520	0.14
91_R	95_H	0.519	0.14
36_K	52_L	0.516	0.14
12_D	65_V	0.514	0.14
31_H	68_G	0.507	0.14
38_E	97_Y	0.506	0.14
20_L	55_N	0.505	0.14
11_Q	98_V	0.503	0.14
16_F	50_G	0.500	0.14
24_I	78_A	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2co5A	2	0.9412	98.8	0.76	Contact Map
3l9fA	2	0.8235	98.6	0.775	Contact Map
1yg2A	2	0.7745	98.4	0.784	Contact Map
2zfwA	2	0.9314	98.4	0.788	Contact Map
3elkA	3	0.9314	98.3	0.79	Contact Map
2e1nA	2	0.9608	98.3	0.795	Contact Map
3f8bA	2	0.902	98.2	0.797	Contact Map
1xmaA	2	0.8529	98.2	0.797	Contact Map
2eshA	2	0.9314	98.2	0.8	Contact Map
2dqlA	2	0.9902	98.1	0.801	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.