Q9HHX7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHX7 - Vng6182h

UniProt:	Q9HHX7	Sequences: MKTTRHATYNLNYHIVWLPKYRQSVLVNEVASRVRSILHEIAADKGVEILDLTVQHDHVHLFVSSPPKNEPALLANWFKGISSRKYNHRYADHDGEKIGWARGYYAGTAGHVSSETVENYIQQHKEGDS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (121)
Sequences:	1753 (1162)
Seq/√Len:	105.6

HALSA - Q9HHX7 Q9HSW8 Q9HM86 Q9HSD5
SULSO - Q97Y68

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_R	89_R	4.480	1.00
33_R	90_Y	2.890	1.00
31_A	125_K	2.678	1.00
38_L	78_F	2.517	1.00
13_Y	65_S	2.310	1.00
37_I	82_S	2.208	1.00
51_D	122_Q	2.156	1.00
38_L	82_S	2.066	1.00
15_I	75_A	2.032	1.00
13_Y	108_T	1.956	1.00
47_V	74_L	1.840	1.00
65_S	71_P	1.831	1.00
62_F	121_I	1.804	1.00
45_K	77_W	1.802	1.00
15_I	63_V	1.790	1.00
9_Y	106_A	1.743	1.00
18_L	101_A	1.704	1.00
119_N	123_Q	1.683	1.00
33_R	36_S	1.658	1.00
85_K	88_H	1.651	1.00
87_N	97_K	1.618	1.00
84_R	88_H	1.555	1.00
119_N	122_Q	1.539	1.00
73_L	76_N	1.518	1.00
18_L	22_R	1.472	1.00
114_S	118_E	1.448	1.00
42_A	49_I	1.439	1.00
63_V	74_L	1.418	1.00
33_R	37_I	1.418	1.00
41_I	45_K	1.392	1.00
11_L	65_S	1.383	1.00
83_S	87_N	1.382	1.00
35_R	39_H	1.378	1.00
26_L	99_G	1.364	1.00
46_G	68_K	1.338	0.99
26_L	34_V	1.304	0.99
11_L	106_A	1.303	0.99
62_F	114_S	1.302	0.99
66_P	69_N	1.294	0.99
34_V	86_Y	1.278	0.99
31_A	35_R	1.260	0.99
48_E	64_S	1.224	0.99
115_E	118_E	1.221	0.99
41_I	81_I	1.211	0.99
65_S	74_L	1.203	0.99
39_H	43_A	1.201	0.99
118_E	122_Q	1.163	0.98
37_I	81_I	1.156	0.98
87_N	94_D	1.153	0.98
113_S	116_T	1.151	0.98
109_A	114_S	1.150	0.98
71_P	75_A	1.109	0.98
42_A	78_F	1.103	0.98
123_Q	126_E	1.098	0.98
71_P	106_A	1.095	0.98
13_Y	71_P	1.093	0.98
42_A	61_L	1.086	0.98
37_I	85_K	1.077	0.98
42_A	47_V	1.073	0.97
38_L	52_L	1.059	0.97
12_N	109_A	1.043	0.97
35_R	54_V	1.038	0.97
13_Y	106_A	1.036	0.97
15_I	71_P	1.014	0.96
70_E	73_L	1.006	0.96
91_A	94_D	0.991	0.96
35_R	53_T	0.991	0.96
69_N	74_L	0.980	0.96
77_W	81_I	0.977	0.96
42_A	74_L	0.976	0.96
40_E	44_D	0.976	0.96
67_P	72_A	0.971	0.95
9_Y	64_S	0.968	0.95
51_D	118_E	0.963	0.95
15_I	106_A	0.962	0.95
11_L	71_P	0.958	0.95
34_V	38_L	0.948	0.95
37_I	41_I	0.927	0.94
83_S	97_K	0.919	0.94
72_A	104_Y	0.900	0.93
77_W	80_G	0.897	0.93
54_V	59_V	0.880	0.92
14_H	109_A	0.878	0.92
38_L	59_V	0.877	0.92
83_S	98_I	0.876	0.92
47_V	69_N	0.875	0.92
35_R	52_L	0.870	0.92
30_V	92_D	0.868	0.92
10_N	107_G	0.867	0.92
62_F	109_A	0.863	0.92
110_G	113_S	0.862	0.92
26_L	86_Y	0.852	0.91
116_T	119_N	0.847	0.91
12_N	64_S	0.844	0.91
12_N	50_L	0.842	0.91
63_V	106_A	0.839	0.90
37_I	40_E	0.828	0.90
41_I	77_W	0.817	0.89
40_E	43_A	0.815	0.89
29_E	33_R	0.801	0.88
30_V	86_Y	0.795	0.88
76_N	102_R	0.795	0.88
87_N	98_I	0.792	0.88
63_V	71_P	0.791	0.88
10_N	64_S	0.773	0.86
36_S	43_A	0.770	0.86
17_W	63_V	0.741	0.84
55_Q	125_K	0.740	0.84
36_S	86_Y	0.726	0.83
26_L	31_A	0.723	0.83
36_S	40_E	0.722	0.82
24_S	57_D	0.721	0.82
31_A	55_Q	0.719	0.82
7_A	11_L	0.714	0.82
27_V	92_D	0.713	0.82
53_T	125_K	0.709	0.81
70_E	75_A	0.709	0.81
73_L	77_W	0.703	0.81
9_Y	13_Y	0.702	0.81
80_G	87_N	0.698	0.80
31_A	54_V	0.694	0.80
76_N	80_G	0.693	0.80
31_A	53_T	0.690	0.80
33_R	86_Y	0.690	0.80
38_L	61_L	0.690	0.80
28_N	125_K	0.687	0.79
49_I	63_V	0.680	0.79
23_Q	96_E	0.674	0.78
112_V	117_V	0.668	0.77
42_A	80_G	0.667	0.77
66_P	70_E	0.666	0.77
80_G	98_I	0.665	0.77
28_N	32_S	0.656	0.76
40_E	85_K	0.652	0.76
115_E	119_N	0.652	0.76
66_P	72_A	0.648	0.75
9_Y	67_P	0.640	0.74
26_L	30_V	0.638	0.74
39_H	49_I	0.636	0.74
50_L	64_S	0.636	0.74
80_G	83_S	0.630	0.73
113_S	121_I	0.626	0.73
86_Y	89_R	0.625	0.73
11_L	108_T	0.622	0.72
30_V	93_H	0.620	0.72
26_L	54_V	0.619	0.72
12_N	114_S	0.615	0.71
51_D	59_V	0.614	0.71
6_H	103_G	0.607	0.70
35_R	55_Q	0.601	0.70
45_K	81_I	0.595	0.69
8_T	103_G	0.588	0.68
121_I	124_H	0.587	0.68
31_A	52_L	0.584	0.67
14_H	60_H	0.575	0.66
81_I	85_K	0.567	0.65
80_G	84_R	0.564	0.65
32_S	36_S	0.562	0.64
38_L	49_I	0.557	0.64
22_R	120_Y	0.556	0.64
63_V	69_N	0.555	0.64
70_E	108_T	0.554	0.63
10_N	105_Y	0.553	0.63
36_S	89_R	0.545	0.62
32_S	43_A	0.536	0.61
12_N	62_F	0.536	0.61
92_D	102_R	0.534	0.61
11_L	70_E	0.530	0.60
18_L	53_T	0.527	0.60
32_S	39_H	0.525	0.59
107_G	113_S	0.523	0.59
91_A	98_I	0.523	0.59
42_A	63_V	0.519	0.58
62_F	112_V	0.517	0.58
81_I	84_R	0.514	0.58
14_H	58_H	0.514	0.58
89_R	95_G	0.513	0.58
19_P	56_H	0.508	0.57
107_G	112_V	0.508	0.57
43_A	49_I	0.506	0.57
46_G	66_P	0.503	0.56
69_N	108_T	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vjvA	2	0.9535	100	0.337	Contact Map
2fyxA	2	0.9767	100	0.344	Contact Map
2f5gA	2	0.9922	100	0.348	Contact Map
4er8A	1	0.938	99.9	0.482	Contact Map
2cveA	1	0.6744	11.3	0.943	Contact Map
4nrdA	3	0.5504	10.8	0.944	Contact Map
4ejnA	1	0.2868	7.6	0.947	Contact Map
2bvlA	1	0.8605	6.3	0.95	Contact Map
1vi7A	1	0.7054	5.9	0.95	Contact Map
3qm3A	4	0.4264	5.7	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.