Q9HHX0 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHX0 - Vng6189h

UniProt:	Q9HHX0	Sequences: MLHCAPAHRTRGPHHGRPLTTVQLDDGSSDTTHELNRRPTGPPALADPIAVTPVLGDYTEPSTDGLVALDTDSWTTTWTHNTAGRPNPPTVADDLLVATSDQGDVTALAASTGDTPWMRTFSDDHQRASIPAPPAIDADSVYITADGAAAQGIYALDRETGETQWEIPGPNIPGPLVRTEDVVLASYDRYELVAFDAGSGDRQWSKEMYDGGPFSPAIGDSRVFSADTNTASEAIVPFLVMVVGGYAGITLADILWEQFFTN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	262 (210)
Sequences:	3671 (3363)
Seq/√Len:	232.1

ECOLI - YNCE TOLB
BACSU - YWHL YXAL YWHK
HALSA - Q9HHX0 Q9HHP3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
209_Y	226_A	4.467	1.00
192_L	226_A	3.431	1.00
186_S	189_R	2.963	1.00
215_S	227_D	2.934	1.00
98_A	108_L	2.823	1.00
154_Y	163_T	2.665	1.00
185_A	189_R	2.640	1.00
87_N	91_V	2.636	1.00
148_A	152_G	2.576	1.00
184_L	189_R	2.558	1.00
105_V	144_T	2.331	1.00
86_P	91_V	2.299	1.00
97_V	136_I	2.148	1.00
209_Y	230_T	2.125	1.00
154_Y	166_E	2.091	1.00
174_G	185_A	2.030	1.00
170_P	184_L	2.021	1.00
214_F	229_N	2.012	1.00
228_T	232_S	2.010	1.00
226_A	236_V	1.963	1.00
176_L	217_A	1.960	1.00
133_P	147_G	1.933	1.00
99_T	131_P	1.921	1.00
153_I	184_L	1.918	1.00
196_D	199_S	1.918	1.00
86_P	89_P	1.900	1.00
193_V	202_R	1.895	1.00
184_L	195_F	1.894	1.00
97_V	107_A	1.888	1.00
193_V	205_S	1.860	1.00
157_D	160_T	1.826	1.00
209_Y	213_P	1.769	1.00
100_S	104_D	1.729	1.00
143_I	182_V	1.703	1.00
225_S	235_I	1.676	1.00
183_V	224_F	1.667	1.00
184_L	188_D	1.667	1.00
143_I	155_A	1.649	1.00
178_R	218_I	1.648	1.00
209_Y	228_T	1.641	1.00
86_P	90_T	1.618	1.00
177_V	218_I	1.618	1.00
106_T	118_M	1.614	1.00
98_A	102_Q	1.575	1.00
97_V	142_Y	1.572	1.00
137_D	140_S	1.463	1.00
143_I	177_V	1.394	1.00
129_S	149_A	1.387	1.00
109_A	112_T	1.378	1.00
45_L	51_V	1.371	1.00
226_A	234_A	1.366	1.00
230_T	234_A	1.360	1.00
144_T	156_L	1.352	1.00
40_T	43_P	1.352	1.00
122_S	144_T	1.325	1.00
173_P	187_Y	1.316	1.00
132_A	149_A	1.314	1.00
184_L	224_F	1.308	1.00
137_D	177_V	1.290	1.00
106_T	115_T	1.284	1.00
30_D	33_H	1.276	1.00
78_W	81_N	1.270	1.00
147_G	172_I	1.257	1.00
143_I	147_G	1.256	1.00
28_S	34_E	1.243	1.00
209_Y	236_V	1.240	1.00
144_T	147_G	1.232	1.00
182_V	185_A	1.225	1.00
30_D	34_E	1.210	1.00
135_A	176_L	1.191	1.00
32_T	38_R	1.162	1.00
32_T	35_L	1.144	1.00
60_E	66_L	1.142	1.00
143_I	183_V	1.138	1.00
183_V	194_A	1.128	1.00
137_D	141_V	1.128	1.00
48_P	51_V	1.122	1.00
216_P	224_F	1.121	1.00
121_F	156_L	1.119	1.00
41_G	44_A	1.114	1.00
37_R	41_G	1.111	1.00
64_D	67_V	1.105	1.00
28_S	32_T	1.104	1.00
49_I	54_V	1.097	1.00
26_D	29_S	1.091	1.00
148_A	151_Q	1.086	1.00
172_I	195_F	1.082	1.00
218_I	224_F	1.081	1.00
46_A	50_A	1.079	1.00
35_L	39_P	1.077	1.00
24_L	28_S	1.075	1.00
186_S	191_E	1.075	1.00
150_A	154_Y	1.065	1.00
70_D	73_S	1.059	1.00
25_D	28_S	1.054	1.00
24_L	27_G	1.048	1.00
45_L	49_I	1.040	1.00
88_P	91_V	1.030	1.00
28_S	31_T	1.022	1.00
50_A	54_V	1.022	1.00
33_H	37_R	1.020	1.00
237_P	240_V	1.020	1.00
163_T	166_E	1.017	1.00
170_P	193_V	1.015	1.00
148_A	154_Y	1.001	1.00
60_E	65_G	1.000	1.00
158_R	161_G	0.996	1.00
179_T	182_V	0.986	1.00
119_R	122_S	0.984	1.00
30_D	37_R	0.982	1.00
225_S	233_E	0.977	1.00
66_L	69_L	0.975	1.00
170_P	191_E	0.967	1.00
87_N	90_T	0.963	1.00
208_M	236_V	0.963	1.00
31_T	34_E	0.962	1.00
194_A	206_K	0.959	1.00
138_A	141_V	0.955	1.00
29_S	32_T	0.946	1.00
25_D	31_T	0.944	1.00
208_M	234_A	0.941	1.00
192_L	206_K	0.935	1.00
61_P	67_V	0.932	1.00
153_I	185_A	0.923	1.00
136_I	177_V	0.920	1.00
50_A	53_P	0.917	1.00
40_T	44_A	0.916	1.00
183_V	189_R	0.916	1.00
133_P	174_G	0.914	1.00
95_L	107_A	0.908	1.00
42_P	45_L	0.906	1.00
136_I	218_I	0.905	1.00
89_P	92_A	0.905	1.00
136_I	158_R	0.904	1.00
60_E	64_D	0.903	0.99
228_T	231_A	0.902	0.99
206_K	224_F	0.901	0.99
95_L	99_T	0.898	0.99
216_P	226_A	0.893	0.99
27_G	31_T	0.888	0.99
81_N	84_G	0.888	0.99
130_I	149_A	0.887	0.99
88_P	99_T	0.885	0.99
144_T	150_A	0.882	0.99
153_I	175_P	0.881	0.99
46_A	49_I	0.877	0.99
25_D	29_S	0.875	0.99
27_G	32_T	0.872	0.99
44_A	48_P	0.872	0.99
181_D	185_A	0.869	0.99
183_V	218_I	0.868	0.99
27_G	30_D	0.867	0.99
43_P	47_D	0.865	0.99
36_N	40_T	0.857	0.99
29_S	36_N	0.845	0.99
24_L	29_S	0.842	0.99
37_R	43_P	0.830	0.99
102_Q	106_T	0.827	0.99
170_P	185_A	0.823	0.99
32_T	37_R	0.818	0.99
26_D	31_T	0.816	0.99
34_E	38_R	0.815	0.99
157_D	196_D	0.814	0.99
33_H	36_N	0.811	0.99
44_A	50_A	0.801	0.99
47_D	56_G	0.799	0.99
73_S	76_T	0.796	0.99
32_T	39_P	0.796	0.99
55_L	61_P	0.791	0.99
78_W	83_A	0.791	0.99
62_S	65_G	0.790	0.99
32_T	41_G	0.788	0.99
77_T	80_H	0.787	0.99
30_D	36_N	0.787	0.99
209_Y	232_S	0.785	0.99
170_P	195_F	0.778	0.99
36_N	39_P	0.776	0.98
32_T	36_N	0.776	0.98
32_T	50_A	0.772	0.98
68_A	72_D	0.768	0.98
213_P	228_T	0.767	0.98
47_D	53_P	0.765	0.98
176_L	216_P	0.764	0.98
169_G	193_V	0.761	0.98
29_S	33_H	0.758	0.98
63_T	66_L	0.753	0.98
26_D	30_D	0.751	0.98
74_W	81_N	0.741	0.98
53_P	58_Y	0.739	0.98
40_T	46_A	0.738	0.98
184_L	187_Y	0.735	0.98
39_P	42_P	0.733	0.98
46_A	52_T	0.728	0.98
143_I	175_P	0.727	0.98
98_A	106_T	0.718	0.97
100_S	108_L	0.716	0.97
28_S	33_H	0.715	0.97
71_T	74_W	0.714	0.97
39_P	45_L	0.711	0.97
25_D	39_P	0.707	0.97
186_S	195_F	0.706	0.97
61_P	64_D	0.704	0.97
29_S	37_R	0.699	0.97
228_T	234_A	0.696	0.97
47_D	50_A	0.693	0.97
169_G	195_F	0.692	0.97
177_V	197_A	0.687	0.97
36_N	42_P	0.687	0.97
164_Q	167_I	0.682	0.97
24_L	34_E	0.679	0.96
132_A	148_A	0.678	0.96
179_T	185_A	0.677	0.96
27_G	34_E	0.672	0.96
100_S	103_G	0.671	0.96
68_A	79_T	0.668	0.96
87_N	92_A	0.667	0.96
26_D	33_H	0.666	0.96
97_V	134_P	0.663	0.96
178_R	181_D	0.661	0.96
31_T	35_L	0.659	0.96
173_P	214_F	0.657	0.96
105_V	134_P	0.656	0.96
51_V	56_G	0.655	0.96
29_S	41_G	0.655	0.96
170_P	188_D	0.653	0.96
174_G	216_P	0.653	0.96
48_P	54_V	0.651	0.96
25_D	32_T	0.650	0.95
44_A	47_D	0.650	0.95
24_L	30_D	0.649	0.95
47_D	51_V	0.648	0.95
52_T	55_L	0.648	0.95
90_T	93_D	0.647	0.95
220_D	223_V	0.646	0.95
121_F	148_A	0.646	0.95
183_V	188_D	0.645	0.95
56_G	62_S	0.644	0.95
180_E	198_G	0.643	0.95
76_T	82_T	0.641	0.95
211_G	229_N	0.639	0.95
61_P	66_L	0.639	0.95
34_E	41_G	0.637	0.95
156_L	163_T	0.635	0.95
54_V	57_D	0.634	0.95
155_A	177_V	0.634	0.95
58_Y	66_L	0.630	0.95
227_D	233_E	0.626	0.94
58_Y	61_P	0.624	0.94
188_D	191_E	0.624	0.94
141_V	223_V	0.621	0.94
86_P	99_T	0.621	0.94
122_S	148_A	0.617	0.94
188_D	193_V	0.614	0.94
183_V	187_Y	0.613	0.94
185_A	226_A	0.613	0.94
131_P	156_L	0.613	0.94
206_K	228_T	0.611	0.94
29_S	35_L	0.604	0.93
43_P	46_A	0.603	0.93
141_V	157_D	0.603	0.93
192_L	216_P	0.602	0.93
37_R	40_T	0.600	0.93
44_A	51_V	0.599	0.93
49_I	53_P	0.596	0.93
76_T	81_N	0.596	0.93
78_W	82_T	0.595	0.93
25_D	33_H	0.590	0.93
102_Q	108_L	0.589	0.93
69_L	73_S	0.586	0.92
30_D	67_V	0.581	0.92
144_T	148_A	0.581	0.92
179_T	184_L	0.577	0.92
34_E	37_R	0.570	0.91
63_T	67_V	0.570	0.91
134_P	144_T	0.570	0.91
60_E	69_L	0.568	0.91
34_E	40_T	0.567	0.91
37_R	47_D	0.560	0.91
59_T	66_L	0.560	0.91
157_D	164_Q	0.557	0.90
43_P	48_P	0.556	0.90
182_V	186_S	0.552	0.90
89_P	93_D	0.548	0.90
173_P	177_V	0.547	0.90
24_L	38_R	0.546	0.89
70_D	76_T	0.545	0.89
62_S	69_L	0.544	0.89
29_S	67_V	0.544	0.89
30_D	35_L	0.543	0.89
48_P	52_T	0.543	0.89
51_V	54_V	0.542	0.89
35_L	38_R	0.541	0.89
31_T	37_R	0.540	0.89
52_T	57_D	0.540	0.89
47_D	54_V	0.538	0.89
28_S	35_L	0.534	0.88
50_A	56_G	0.534	0.88
160_T	199_S	0.534	0.88
94_D	99_T	0.534	0.88
39_P	43_P	0.532	0.88
52_T	58_Y	0.530	0.88
25_D	30_D	0.528	0.88
181_D	184_L	0.526	0.88
61_P	65_G	0.526	0.88
99_T	134_P	0.526	0.88
184_L	193_V	0.523	0.87
86_P	98_A	0.517	0.87
178_R	221_S	0.514	0.86
33_H	44_A	0.508	0.86
26_D	34_E	0.507	0.86
45_L	56_G	0.506	0.86
42_P	48_P	0.506	0.86
181_D	189_R	0.505	0.85
59_T	63_T	0.502	0.85
155_A	197_A	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vyhC	1	0.7176	100	0.443	Contact Map
4j73A	1	0.7061	99.9	0.46	Contact Map
4j87A	1	0.7023	99.9	0.468	Contact Map
4u1eI	1	0.6908	99.9	0.475	Contact Map
4j0wA	1	0.7252	99.9	0.483	Contact Map
1gotB	1	0.8626	99.9	0.483	Contact Map
3sfzA	1	0.9656	99.9	0.486	Contact Map
4xfvA	1	0.687	99.9	0.487	Contact Map
3mkqA	2	0.7099	99.9	0.491	Contact Map
3ow8A	3	0.7863	99.9	0.493	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.