Q9HHS4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHS4 - Vng6254c

UniProt:	Q9HHS4	Sequences: MIVVHATFRFDPDARDDALELIADLVEQSQTEDGLIDYRAAVDVSDPNVVRFFEQYEDAAAFDAHSQTDHFQAFEQQLPELLAGEPEIRRFDVDSVTEPPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	101 (89)
Sequences:	1333 (998)
Seq/√Len:	105.8

ECOLI - LSRG YGIN
BACSU - YCNE
HALSA - Q9HHS4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_A	63_D	3.092	1.00
4_V	62_F	2.557	1.00
15_R	48_N	2.504	1.00
14_A	17_D	2.382	1.00
58_D	61_A	2.368	1.00
69_D	73_A	2.132	1.00
34_G	61_A	2.116	1.00
7_T	49_V	2.073	1.00
11_D	83_A	1.994	1.00
15_R	42_V	1.933	1.00
67_Q	72_Q	1.900	1.00
19_L	42_V	1.850	1.00
9_R	84_G	1.840	1.00
10_F	18_A	1.808	1.00
19_L	23_A	1.632	1.00
5_H	91_F	1.615	1.00
28_Q	31_T	1.538	1.00
24_D	73_A	1.502	1.00
37_D	55_Q	1.469	1.00
25_L	74_F	1.455	1.00
35_L	56_Y	1.451	1.00
73_A	77_Q	1.443	1.00
62_F	66_S	1.442	1.00
9_R	49_V	1.377	1.00
60_A	64_A	1.360	1.00
74_F	78_L	1.317	0.99
60_A	63_D	1.302	0.99
59_A	90_R	1.292	0.99
33_D	57_E	1.263	0.99
29_S	71_F	1.251	0.99
56_Y	62_F	1.238	0.99
18_A	22_I	1.229	0.99
21_L	24_D	1.215	0.99
68_T	71_F	1.193	0.99
36_I	57_E	1.163	0.98
3_V	53_F	1.154	0.98
51_R	91_F	1.141	0.98
9_R	46_D	1.135	0.98
8_F	74_F	1.114	0.98
63_D	66_S	1.077	0.98
7_T	87_E	1.073	0.97
16_D	20_E	1.059	0.97
42_V	50_V	1.038	0.97
14_A	81_L	1.038	0.97
5_H	51_R	1.035	0.97
46_D	49_V	1.032	0.97
24_D	28_Q	1.008	0.96
6_A	38_Y	1.002	0.96
29_S	66_S	0.991	0.96
3_V	55_Q	0.984	0.96
37_D	53_F	0.976	0.96
76_Q	79_P	0.973	0.95
25_L	38_Y	0.971	0.95
43_D	49_V	0.948	0.95
33_D	61_A	0.915	0.94
40_A	50_V	0.912	0.94
33_D	64_A	0.911	0.94
8_F	18_A	0.905	0.93
32_E	65_H	0.891	0.93
10_F	28_Q	0.873	0.92
41_A	51_R	0.866	0.92
57_E	61_A	0.864	0.92
11_D	14_A	0.847	0.91
15_R	19_L	0.836	0.90
22_I	40_A	0.830	0.90
77_Q	80_E	0.824	0.90
8_F	82_L	0.822	0.90
21_L	77_Q	0.814	0.89
18_A	81_L	0.814	0.89
29_S	40_A	0.811	0.89
10_F	22_I	0.802	0.88
32_E	61_A	0.799	0.88
72_Q	76_Q	0.796	0.88
66_S	74_F	0.794	0.88
5_H	53_F	0.788	0.88
30_Q	56_Y	0.788	0.88
82_L	85_E	0.785	0.87
84_G	87_E	0.779	0.87
42_V	47_P	0.772	0.86
13_D	83_A	0.767	0.86
42_V	46_D	0.764	0.86
63_D	67_Q	0.764	0.86
6_A	25_L	0.760	0.86
21_L	81_L	0.754	0.85
26_V	30_Q	0.753	0.85
40_A	52_F	0.723	0.83
71_F	75_E	0.721	0.82
41_A	53_F	0.717	0.82
30_Q	35_L	0.711	0.82
8_F	79_P	0.710	0.81
21_L	52_F	0.709	0.81
66_S	71_F	0.694	0.80
10_F	50_V	0.683	0.79
4_V	66_S	0.679	0.79
3_V	91_F	0.676	0.78
7_T	89_R	0.661	0.77
78_L	82_L	0.661	0.77
17_D	81_L	0.657	0.76
28_Q	70_H	0.654	0.76
43_D	46_D	0.649	0.75
12_P	20_E	0.645	0.75
6_A	71_F	0.635	0.74
18_A	40_A	0.635	0.74
18_A	78_L	0.631	0.73
19_L	50_V	0.620	0.72
32_E	70_H	0.615	0.71
23_A	27_E	0.615	0.71
6_A	52_F	0.611	0.71
29_S	32_E	0.610	0.71
30_Q	39_R	0.598	0.69
42_V	48_N	0.597	0.69
56_Y	66_S	0.593	0.69
41_A	44_V	0.590	0.68
15_R	50_V	0.586	0.68
38_Y	70_H	0.581	0.67
75_E	86_P	0.571	0.66
77_Q	81_L	0.568	0.65
11_D	80_E	0.556	0.64
29_S	56_Y	0.553	0.63
14_A	80_E	0.552	0.63
44_V	57_E	0.549	0.63
74_F	82_L	0.545	0.62
10_F	48_N	0.538	0.61
47_P	55_Q	0.525	0.59
22_I	52_F	0.524	0.59
16_D	23_A	0.524	0.59
74_F	86_P	0.523	0.59
29_S	70_H	0.520	0.59
25_L	71_F	0.512	0.57
20_E	24_D	0.511	0.57
38_Y	71_F	0.506	0.57
6_A	40_A	0.504	0.56
35_L	38_Y	0.503	0.56
32_E	57_E	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mcsA	1	1	99.9	0.312	Contact Map
2omoA	2	0.9703	99.9	0.315	Contact Map
2gffA	2	0.9901	99.9	0.332	Contact Map
3f44A	1	1	99.9	0.339	Contact Map
2pd1A	5	0.9802	99.9	0.34	Contact Map
1tuvA	2	0.9208	99.8	0.341	Contact Map
3e8oA	2	0.9802	99.8	0.348	Contact Map
3bm7A	2	0.9406	99.8	0.349	Contact Map
3gz7A	2	0.9406	99.8	0.352	Contact Map
1q8bA	2	0.901	99.8	0.356	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.