Q9HHP1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHP1 - Hydrogenase expression/formation protein

UniProt:	Q9HHP1	Sequences: MATECERLGVSVVTGHTARQDVSFPWIGGATAMGVGDPAEIVRPDGATAGDTVLMTHSPGAEVAGLFAALFGDHLDVADDTVERADARLEDTTVVGDACAAASAPVTAMHDATECGIQGALVELATAAGVSISVSSDAVPVPEDVSAVCADLGLDPWQVSSRGTLLVTVPEAHADTAMAALDARNTPVAAIGTVSEGSGVTVDGTQVVHPGSDPAWTVFSALQRDAAARSP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	231 (195)
Sequences:	11462 (8510)
Seq/√Len:	609.4

ECOLI - HYPE SELD THIL PUR4
BACSU - PURL THIL
HALSA - Q9HHP1 Q9HSM1 THIL PURL
SULSO - Q7LY06 Q97VC5 Q980P9 PURL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_T	190_A	3.543	1.00
133_S	195_S	2.929	1.00
135_S	138_A	2.854	1.00
133_S	193_T	2.799	1.00
173_H	176_T	2.620	1.00
52_T	174_A	2.571	1.00
130_V	194_V	2.514	1.00
51_D	107_T	2.481	1.00
54_L	190_A	2.452	1.00
125_A	132_I	2.434	1.00
169_V	177_A	2.402	1.00
52_T	193_T	2.359	1.00
133_S	201_T	2.195	1.00
121_L	132_I	2.184	1.00
105_P	173_H	2.181	1.00
170_P	173_H	2.085	1.00
121_L	134_V	2.000	1.00
54_L	174_A	1.959	1.00
174_A	178_M	1.943	1.00
49_A	196_E	1.923	1.00
53_V	168_T	1.922	1.00
107_T	170_P	1.919	1.00
181_L	188_V	1.916	1.00
52_T	171_E	1.865	1.00
174_A	190_A	1.834	1.00
54_L	178_M	1.796	1.00
54_L	169_V	1.790	1.00
131_S	197_G	1.789	1.00
171_E	193_T	1.779	1.00
107_T	168_T	1.688	1.00
112_A	120_A	1.666	1.00
42_V	109_M	1.641	1.00
112_A	166_L	1.638	1.00
178_M	182_D	1.604	1.00
131_S	195_S	1.574	1.00
47_A	168_T	1.573	1.00
51_D	194_V	1.572	1.00
53_V	132_I	1.556	1.00
61_A	142_P	1.555	1.00
178_M	188_V	1.544	1.00
54_L	188_V	1.535	1.00
20_Q	27_I	1.531	1.00
48_T	107_T	1.525	1.00
108_A	168_T	1.509	1.00
121_L	166_L	1.499	1.00
47_A	194_V	1.498	1.00
175_D	178_M	1.494	1.00
176_T	179_A	1.491	1.00
49_A	130_V	1.479	1.00
124_L	168_T	1.458	1.00
175_D	179_A	1.454	1.00
132_I	194_V	1.441	1.00
48_T	170_P	1.439	1.00
58_S	61_A	1.423	1.00
36_G	41_I	1.412	1.00
168_T	194_V	1.393	1.00
190_A	193_T	1.390	1.00
110_H	123_E	1.368	1.00
117_I	191_I	1.365	1.00
51_D	170_P	1.351	1.00
179_A	183_A	1.344	1.00
51_D	168_T	1.343	1.00
180_A	184_R	1.334	1.00
103_S	180_A	1.328	1.00
108_A	124_L	1.328	1.00
85_A	88_R	1.320	1.00
176_T	180_A	1.308	1.00
87_A	90_E	1.277	1.00
109_M	167_V	1.271	1.00
42_V	101_A	1.269	1.00
43_R	47_A	1.229	1.00
169_V	174_A	1.223	1.00
135_S	193_T	1.208	1.00
84_R	88_R	1.191	1.00
180_A	183_A	1.188	1.00
37_D	40_E	1.185	1.00
5_C	12_V	1.183	1.00
54_L	177_A	1.172	1.00
3_T	6_E	1.164	1.00
43_R	46_G	1.134	1.00
52_T	169_V	1.131	1.00
131_S	198_S	1.119	1.00
92_T	95_V	1.116	1.00
63_V	66_L	1.111	1.00
4_E	7_R	1.103	1.00
179_A	182_D	1.098	1.00
120_A	166_L	1.092	1.00
93_T	96_G	1.084	1.00
157_W	160_S	1.073	1.00
161_S	164_T	1.068	1.00
94_V	181_L	1.066	1.00
40_E	102_A	1.056	1.00
85_A	89_L	1.031	1.00
3_T	7_R	1.024	1.00
121_L	125_A	1.023	1.00
160_S	163_G	1.018	1.00
47_A	128_A	1.005	1.00
125_A	200_V	1.004	1.00
20_Q	24_F	1.002	1.00
92_T	96_G	1.002	1.00
140_P	189_A	0.997	1.00
59_P	62_E	0.992	1.00
147_A	150_A	0.990	1.00
40_E	104_A	0.974	1.00
110_H	166_L	0.971	1.00
49_A	195_S	0.967	1.00
111_D	123_E	0.964	1.00
78_A	81_T	0.964	1.00
122_V	126_T	0.963	1.00
81_T	84_R	0.963	1.00
119_G	123_E	0.958	1.00
58_S	187_P	0.954	1.00
105_P	176_T	0.947	1.00
83_E	87_A	0.944	1.00
201_T	206_Q	0.937	1.00
203_D	206_Q	0.937	1.00
177_A	181_L	0.936	1.00
81_T	88_R	0.932	1.00
79_D	83_E	0.929	1.00
65_G	69_A	0.928	1.00
158_Q	161_S	0.924	1.00
50_G	193_T	0.920	1.00
103_S	176_T	0.919	1.00
62_E	65_G	0.918	1.00
48_T	51_D	0.916	1.00
44_P	127_A	0.914	1.00
81_T	85_A	0.914	1.00
46_G	53_V	0.905	1.00
65_G	68_A	0.902	1.00
42_V	106_V	0.900	1.00
67_F	70_L	0.892	1.00
47_A	124_L	0.890	1.00
112_A	164_T	0.883	1.00
66_L	69_A	0.882	1.00
112_A	117_I	0.868	1.00
83_E	86_D	0.865	1.00
91_D	165_L	0.865	1.00
88_R	92_T	0.851	1.00
20_Q	25_P	0.847	1.00
66_L	70_L	0.839	1.00
5_C	10_V	0.838	1.00
109_M	165_L	0.834	1.00
68_A	71_F	0.831	1.00
72_G	75_L	0.826	1.00
62_E	161_S	0.825	1.00
46_G	107_T	0.812	1.00
54_L	167_V	0.810	1.00
49_A	52_T	0.809	1.00
64_A	145_V	0.801	1.00
167_V	177_A	0.798	1.00
195_S	198_S	0.796	1.00
84_R	87_A	0.796	1.00
53_V	194_V	0.790	1.00
178_M	190_A	0.778	1.00
88_R	91_D	0.774	1.00
125_A	194_V	0.771	1.00
86_D	90_E	0.762	1.00
94_V	97_D	0.761	1.00
64_A	68_A	0.761	1.00
100_A	104_A	0.758	1.00
55_M	59_P	0.758	1.00
50_G	171_E	0.752	1.00
45_D	127_A	0.752	1.00
66_L	71_F	0.750	1.00
197_G	201_T	0.750	1.00
65_G	70_L	0.748	1.00
44_P	47_A	0.745	1.00
117_I	166_L	0.744	1.00
138_A	189_A	0.743	1.00
121_L	191_I	0.738	1.00
56_T	165_L	0.736	1.00
63_V	67_F	0.733	1.00
52_T	55_M	0.732	1.00
37_D	102_A	0.732	1.00
93_T	97_D	0.731	1.00
59_P	164_T	0.728	1.00
82_V	85_A	0.728	1.00
100_A	177_A	0.722	1.00
105_P	180_A	0.719	1.00
72_G	76_D	0.713	1.00
118_Q	122_V	0.712	1.00
102_A	105_P	0.704	1.00
195_S	201_T	0.702	1.00
71_F	75_L	0.697	1.00
110_H	124_L	0.693	1.00
120_A	123_E	0.689	1.00
56_T	167_V	0.689	1.00
55_M	112_A	0.688	1.00
45_D	128_A	0.686	1.00
82_V	86_D	0.675	1.00
136_S	203_D	0.675	1.00
137_D	203_D	0.674	1.00
119_G	158_Q	0.673	1.00
42_V	46_G	0.670	1.00
110_H	119_G	0.669	1.00
46_G	124_L	0.668	1.00
125_A	128_A	0.665	1.00
71_F	74_H	0.662	1.00
84_R	91_D	0.655	1.00
132_I	192_G	0.654	1.00
143_E	147_A	0.654	1.00
46_G	168_T	0.654	1.00
55_M	164_T	0.653	1.00
83_E	88_R	0.653	1.00
44_P	110_H	0.652	1.00
133_S	136_S	0.652	1.00
17_T	20_Q	0.651	1.00
14_T	29_G	0.644	1.00
80_D	83_E	0.643	1.00
56_T	181_L	0.641	1.00
104_A	180_A	0.639	1.00
53_V	124_L	0.639	1.00
5_C	30_A	0.639	1.00
77_V	81_T	0.635	1.00
90_E	94_V	0.631	1.00
62_E	85_A	0.630	1.00
97_D	103_S	0.630	1.00
81_T	144_D	0.629	1.00
124_L	128_A	0.628	1.00
83_E	90_E	0.625	1.00
88_R	93_T	0.624	1.00
106_V	109_M	0.622	1.00
50_G	194_V	0.616	1.00
122_V	200_V	0.613	1.00
138_A	190_A	0.612	1.00
139_V	191_I	0.612	1.00
141_V	146_S	0.604	1.00
169_V	173_H	0.602	1.00
56_T	164_T	0.601	1.00
146_S	150_A	0.599	1.00
47_A	108_A	0.599	1.00
49_A	194_V	0.598	1.00
96_G	100_A	0.596	1.00
106_V	167_V	0.595	1.00
101_A	104_A	0.593	1.00
16_H	20_Q	0.589	1.00
130_V	196_E	0.588	1.00
118_Q	202_V	0.588	1.00
38_P	41_I	0.587	1.00
47_A	130_V	0.587	1.00
51_D	171_E	0.584	1.00
177_A	188_V	0.583	1.00
58_S	142_P	0.583	1.00
175_D	182_D	0.581	1.00
57_H	164_T	0.576	1.00
107_T	173_H	0.573	1.00
64_A	114_E	0.572	1.00
144_D	147_A	0.569	1.00
101_A	109_M	0.566	1.00
13_V	17_T	0.562	1.00
159_V	162_R	0.560	1.00
58_S	164_T	0.557	1.00
10_V	32_A	0.554	1.00
59_P	112_A	0.553	1.00
119_G	122_V	0.551	0.99
14_T	32_A	0.550	0.99
150_A	203_D	0.550	0.99
101_A	105_P	0.546	0.99
64_A	159_V	0.545	0.99
59_P	117_I	0.545	0.99
124_L	132_I	0.545	0.99
55_M	117_I	0.544	0.99
171_E	174_A	0.544	0.99
63_V	68_A	0.544	0.99
50_G	55_M	0.543	0.99
5_C	13_V	0.541	0.99
117_I	139_V	0.540	0.99
100_A	103_S	0.540	0.99
46_G	108_A	0.538	0.99
181_L	186_T	0.536	0.99
174_A	177_A	0.531	0.99
125_A	131_S	0.530	0.99
91_D	164_T	0.529	0.99
15_G	111_D	0.529	0.99
7_R	85_A	0.528	0.99
89_L	92_T	0.527	0.99
79_D	82_V	0.523	0.99
110_H	114_E	0.521	0.99
143_E	146_S	0.520	0.99
97_D	183_A	0.518	0.99
63_V	159_V	0.513	0.99
73_D	76_D	0.512	0.99
47_A	107_T	0.509	0.99
24_F	27_I	0.509	0.99
48_T	130_V	0.506	0.99
11_S	19_R	0.504	0.99
110_H	113_T	0.502	0.99
70_L	75_L	0.502	0.99
149_C	159_V	0.500	0.99
70_L	73_D	0.500	0.99
111_D	114_E	0.500	0.99
80_D	84_R	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lgyA	1	0.9437	100	0.277	Contact Map
3viuA	1	0.9221	100	0.288	Contact Map
3fd5A	2	0.8961	100	0.312	Contact Map
1vk3A	1	0.8961	100	0.349	Contact Map
2rb9A	2	0.9221	100	0.353	Contact Map
3vtiC	2	0.8831	100	0.357	Contact Map
2z1uA	2	0.9134	100	0.358	Contact Map
2btuA	2	0.8485	100	0.362	Contact Map
3wjpA	2	0.9048	100	0.365	Contact Map
2zodA	2	0.8442	100	0.384	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.