Q9HHN6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHN6 - Vng6306c

UniProt:	Q9HHN6	Sequences: MRSAQSKRSQSTATGERTLHIGRDRPIRISAGHRLQHHDGKCSRPHGHNYEISVEITGQLTDEGWVVDKGTVTAVVSDWDHRFLLEDGDPLVDAFREAGDGDAVVVLEQPPTAEVMGVVLERKLHDALPETVSAVSVTVAETPALTAGPN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (115)
Sequences:	1492 (863)
Seq/√Len:	80.5

ECOLI - QUED
BACSU - QUED
HALSA - Q9HHN6 Q9HQS7
SULSO - Q97W30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_G	66_V	3.366	1.00
30_S	49_N	3.161	1.00
136_S	148_G	2.846	1.00
24_D	55_E	2.818	1.00
138_T	148_G	2.776	1.00
26_P	51_E	2.444	1.00
57_T	135_V	2.433	1.00
52_I	139_V	2.318	1.00
118_V	122_R	2.235	1.00
41_K	70_G	2.032	1.00
79_W	119_V	2.011	1.00
53_S	138_T	1.983	1.00
54_V	76_V	1.961	1.00
22_G	57_T	1.896	1.00
53_S	140_A	1.869	1.00
26_P	53_S	1.852	1.00
121_E	149_P	1.814	1.00
49_N	143_P	1.775	1.00
22_G	55_E	1.743	1.00
56_I	72_V	1.729	1.00
56_I	67_V	1.688	1.00
78_D	127_A	1.610	1.00
79_W	120_L	1.567	1.00
123_K	126_D	1.540	0.99
64_G	115_V	1.536	0.99
25_R	145_L	1.514	0.99
27_I	76_V	1.477	0.99
36_Q	43_S	1.459	0.99
68_D	71_T	1.448	0.99
54_V	124_L	1.447	0.99
24_D	53_S	1.433	0.99
65_W	112_T	1.419	0.99
21_I	118_V	1.395	0.99
24_D	138_T	1.373	0.99
22_G	135_V	1.364	0.99
117_G	137_V	1.357	0.99
29_I	52_I	1.356	0.99
87_D	108_E	1.343	0.99
21_I	60_L	1.333	0.98
29_I	139_V	1.300	0.98
84_L	107_L	1.297	0.98
30_S	143_P	1.224	0.97
27_I	73_T	1.222	0.97
74_A	78_D	1.220	0.97
28_R	144_A	1.205	0.97
118_V	149_P	1.203	0.97
109_Q	119_V	1.145	0.96
31_A	84_L	1.139	0.96
119_V	123_K	1.134	0.96
45_P	83_F	1.132	0.96
34_R	83_F	1.130	0.96
25_R	144_A	1.128	0.96
51_E	143_P	1.125	0.96
32_G	83_F	1.105	0.95
22_G	136_S	1.098	0.95
25_R	142_T	1.057	0.94
89_D	92_V	1.045	0.93
69_K	145_L	1.006	0.92
115_V	118_V	1.000	0.92
125_H	129_P	0.998	0.92
24_D	146_T	0.986	0.91
122_R	126_D	0.971	0.91
21_I	149_P	0.964	0.90
138_T	146_T	0.956	0.90
79_W	116_M	0.943	0.89
44_R	82_R	0.942	0.89
43_S	112_T	0.940	0.89
50_Y	113_A	0.918	0.88
72_V	131_T	0.912	0.88
122_R	125_H	0.900	0.87
55_E	136_S	0.895	0.87
85_L	89_D	0.893	0.87
71_T	74_A	0.891	0.87
85_L	91_L	0.888	0.86
54_V	137_V	0.871	0.85
26_P	144_A	0.866	0.85
23_R	67_V	0.862	0.85
63_E	110_P	0.851	0.84
110_P	113_A	0.840	0.83
50_Y	142_T	0.819	0.82
37_H	63_E	0.811	0.81
24_D	148_G	0.807	0.81
121_E	134_A	0.803	0.80
67_V	75_V	0.798	0.80
31_A	50_Y	0.792	0.79
120_L	124_L	0.792	0.79
25_R	49_N	0.788	0.79
28_R	51_E	0.783	0.79
79_W	123_K	0.779	0.78
55_E	64_G	0.775	0.78
57_T	133_S	0.745	0.75
72_V	85_L	0.745	0.75
45_P	69_K	0.743	0.75
21_I	52_I	0.737	0.74
23_R	32_G	0.733	0.74
117_G	147_A	0.722	0.73
88_G	107_L	0.718	0.72
121_E	137_V	0.714	0.72
69_K	73_T	0.711	0.72
139_V	147_A	0.694	0.70
67_V	73_T	0.692	0.70
34_R	89_D	0.686	0.69
49_N	144_A	0.679	0.68
85_L	111_P	0.676	0.68
114_E	117_G	0.675	0.68
60_L	125_H	0.664	0.66
83_F	142_T	0.663	0.66
28_R	143_P	0.662	0.66
28_R	32_G	0.659	0.66
55_E	138_T	0.659	0.66
142_T	145_L	0.658	0.66
25_R	76_V	0.656	0.65
49_N	82_R	0.649	0.65
27_I	77_S	0.647	0.64
35_L	38_H	0.644	0.64
27_I	52_I	0.643	0.64
52_I	124_L	0.634	0.63
115_V	119_V	0.632	0.63
138_T	147_A	0.628	0.62
35_L	40_G	0.627	0.62
75_V	124_L	0.627	0.62
51_E	140_A	0.612	0.60
27_I	145_L	0.612	0.60
34_R	38_H	0.609	0.60
34_R	112_T	0.605	0.59
27_I	142_T	0.605	0.59
126_D	131_T	0.601	0.59
62_D	92_V	0.601	0.59
75_V	132_V	0.600	0.59
60_L	69_K	0.591	0.57
124_L	137_V	0.585	0.57
41_K	122_R	0.585	0.57
54_V	72_V	0.579	0.56
118_V	146_T	0.578	0.56
126_D	134_A	0.574	0.55
78_D	82_R	0.572	0.55
117_G	148_G	0.571	0.55
32_G	142_T	0.569	0.55
116_M	120_L	0.568	0.54
59_Q	62_D	0.564	0.54
28_R	116_M	0.564	0.54
42_C	81_H	0.562	0.54
45_P	50_Y	0.560	0.53
35_L	145_L	0.558	0.53
75_V	139_V	0.553	0.53
58_G	85_L	0.552	0.52
24_D	147_A	0.552	0.52
111_P	114_E	0.552	0.52
123_K	129_P	0.548	0.52
89_D	107_L	0.548	0.52
120_L	139_V	0.548	0.52
72_V	112_T	0.547	0.52
37_H	43_S	0.547	0.52
57_T	122_R	0.546	0.52
60_L	149_P	0.544	0.51
57_T	108_E	0.535	0.50
120_L	147_A	0.534	0.50
59_Q	133_S	0.531	0.50
32_G	67_V	0.531	0.50
73_T	113_A	0.531	0.50
125_H	133_S	0.528	0.49
125_H	134_A	0.525	0.49
140_A	146_T	0.525	0.49
50_Y	139_V	0.522	0.48
67_V	131_T	0.522	0.48
61_T	71_T	0.521	0.48
26_P	143_P	0.516	0.48
124_L	134_A	0.513	0.47
109_Q	115_V	0.509	0.47
121_E	125_H	0.502	0.46
67_V	126_D	0.501	0.46
37_H	40_G	0.500	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3jygA	4	0.88	100	0.276	Contact Map
1b66A	4	0.7867	100	0.297	Contact Map
3d7jA	4	0.7867	100	0.305	Contact Map
2g64A	4	0.8067	100	0.314	Contact Map
3lx3A	4	0.8733	100	0.319	Contact Map
1y13A	5	0.8733	100	0.319	Contact Map
2obaA	4	0.7467	100	0.323	Contact Map
2dj6A	3	0.7333	100	0.329	Contact Map
4ntkA	4	0.7467	100	0.333	Contact Map
1wwjA	4	0.3867	19.7	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.