Q9HHK1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHK1 - Vng6357h

UniProt:	Q9HHK1	Sequences: MNDRNPPEEFADVNEAVGEEWEAETTPYERIRHVVAHTYSPVSADAVADDARTAPKTARKHLNTLADEGFVETTPGEQGGTLYRRSPESLVVEQAADILEHVSTDELVTRIQEMREQLTEYRSEFGVDSPEELAVNQTNQALSETGSPQDEIDPETIREWKTLRRNLAFANAALSIGNAEQFVDSDRRSTDDSVPA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (156)
Sequences:	186 (132)
Seq/√Len:	10.6

HALSA - Q9HHK1 O51987 Q9HHH4 Q9HHH1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_V	71_V	4.285	0.99
98_I	107_L	3.018	0.94
114_M	163_L	2.647	0.89
31_I	54_A	2.612	0.88
127_V	157_I	2.458	0.84
109_T	125_F	2.456	0.84
103_S	106_E	2.024	0.70
122_R	128_D	2.024	0.70
105_D	123_S	2.022	0.70
61_H	65_L	1.967	0.68
29_E	172_A	1.952	0.68
124_E	127_V	1.952	0.68
27_P	54_A	1.893	0.65
123_S	131_E	1.870	0.64
22_E	52_R	1.841	0.63
28_Y	61_H	1.825	0.62
28_Y	65_L	1.824	0.62
120_E	127_V	1.814	0.62
66_A	113_E	1.788	0.60
113_E	126_G	1.772	0.60
89_S	93_E	1.755	0.59
115_R	167_L	1.735	0.58
86_S	92_V	1.719	0.57
124_E	132_E	1.707	0.57
76_G	103_S	1.704	0.57
133_L	157_I	1.674	0.55
92_V	99_L	1.656	0.54
47_V	103_S	1.608	0.52
31_I	146_G	1.559	0.50
54_A	57_T	1.556	0.50
166_N	170_A	1.551	0.49
125_F	156_T	1.545	0.49
90_L	98_I	1.527	0.48
91_V	179_A	1.508	0.47
123_S	126_G	1.474	0.46
94_Q	154_P	1.464	0.45
120_E	123_S	1.463	0.45
18_G	120_E	1.423	0.43
75_P	174_L	1.398	0.42
68_E	89_S	1.394	0.42
41_P	83_Y	1.384	0.42
29_E	57_T	1.362	0.41
66_A	71_V	1.349	0.40
38_T	111_I	1.343	0.40
90_L	157_I	1.337	0.39
53_T	57_T	1.327	0.39
35_V	38_T	1.321	0.39
31_I	65_L	1.316	0.39
126_G	178_N	1.312	0.38
119_T	149_Q	1.300	0.38
27_P	133_L	1.277	0.37
26_T	31_I	1.263	0.36
172_A	179_A	1.260	0.36
34_V	65_L	1.256	0.36
107_L	164_R	1.255	0.36
49_D	113_E	1.252	0.36
54_A	65_L	1.223	0.34
31_I	39_Y	1.217	0.34
30_R	54_A	1.213	0.34
26_T	60_K	1.206	0.34
111_I	167_L	1.194	0.33
89_S	92_V	1.171	0.32
66_A	146_G	1.162	0.32
42_V	86_S	1.151	0.31
71_V	76_G	1.146	0.31
57_T	61_H	1.132	0.31
123_S	175_S	1.126	0.30
76_G	80_G	1.122	0.30
59_R	130_P	1.121	0.30
113_E	131_E	1.114	0.30
49_D	52_R	1.101	0.29
26_T	43_S	1.101	0.29
40_S	46_A	1.096	0.29
60_K	63_N	1.069	0.28
111_I	154_P	1.063	0.28
134_A	177_G	1.055	0.28
31_I	64_T	1.039	0.27
55_P	59_R	1.039	0.27
131_E	164_R	1.035	0.27
34_V	105_D	1.033	0.27
88_E	121_Y	1.028	0.27
112_Q	157_I	1.022	0.26
116_E	127_V	1.010	0.26
59_R	94_Q	1.008	0.26
73_T	95_A	0.999	0.26
49_D	175_S	0.984	0.25
92_V	114_M	0.983	0.25
95_A	98_I	0.979	0.25
32_R	91_V	0.967	0.24
69_G	85_R	0.960	0.24
95_A	129_S	0.952	0.24
37_H	92_V	0.940	0.24
80_G	170_A	0.939	0.24
54_A	76_G	0.921	0.23
56_K	175_S	0.914	0.23
122_R	129_S	0.912	0.23
125_F	136_N	0.912	0.23
53_T	58_A	0.905	0.22
39_Y	99_L	0.904	0.22
124_E	156_T	0.902	0.22
42_V	133_L	0.898	0.22
28_Y	60_K	0.897	0.22
120_E	129_S	0.895	0.22
106_E	128_D	0.894	0.22
49_D	132_E	0.888	0.22
53_T	96_A	0.885	0.22
70_F	123_S	0.883	0.22
86_S	133_L	0.874	0.21
61_H	64_T	0.872	0.21
85_R	157_I	0.872	0.21
46_A	148_P	0.867	0.21
23_A	119_T	0.866	0.21
85_R	90_L	0.865	0.21
125_F	155_E	0.864	0.21
31_I	52_R	0.858	0.21
43_S	82_L	0.856	0.21
73_T	152_I	0.854	0.21
44_A	77_E	0.852	0.21
44_A	122_R	0.852	0.21
24_E	86_S	0.839	0.20
125_F	132_E	0.837	0.20
123_S	149_Q	0.835	0.20
118_L	163_L	0.831	0.20
36_A	91_V	0.816	0.20
130_P	164_R	0.815	0.20
161_K	177_G	0.815	0.20
26_T	29_E	0.815	0.20
30_R	53_T	0.807	0.19
117_Q	121_Y	0.802	0.19
80_G	133_L	0.801	0.19
85_R	134_A	0.801	0.19
86_S	89_S	0.800	0.19
17_V	106_E	0.800	0.19
67_D	72_E	0.794	0.19
42_V	46_A	0.793	0.19
154_P	170_A	0.792	0.19
53_T	125_F	0.789	0.19
46_A	120_E	0.789	0.19
45_D	158_R	0.784	0.19
41_P	121_Y	0.784	0.19
37_H	177_G	0.779	0.19
23_A	101_H	0.775	0.18
25_T	74_T	0.769	0.18
92_V	133_L	0.767	0.18
112_Q	138_T	0.762	0.18
42_V	107_L	0.761	0.18
28_Y	56_K	0.760	0.18
126_G	131_E	0.745	0.18
50_D	94_Q	0.743	0.18
70_F	89_S	0.739	0.17
36_A	82_L	0.733	0.17
121_Y	156_T	0.732	0.17
64_T	88_E	0.731	0.17
118_L	122_R	0.722	0.17
135_V	158_R	0.720	0.17
67_D	120_E	0.719	0.17
118_L	167_L	0.713	0.17
59_R	85_R	0.704	0.16
131_E	152_I	0.701	0.16
70_F	179_A	0.691	0.16
40_S	165_R	0.691	0.16
71_V	114_M	0.679	0.16
29_E	63_N	0.679	0.16
88_E	170_A	0.674	0.16
80_G	89_S	0.670	0.16
67_D	146_G	0.669	0.16
118_L	147_S	0.667	0.16
72_E	84_R	0.663	0.15
110_R	166_N	0.663	0.15
116_E	124_E	0.662	0.15
26_T	171_N	0.661	0.15
123_S	128_D	0.657	0.15
35_V	78_Q	0.656	0.15
59_R	162_T	0.656	0.15
24_E	117_Q	0.650	0.15
80_G	136_N	0.650	0.15
90_L	133_L	0.645	0.15
47_V	53_T	0.632	0.15
55_P	119_T	0.632	0.15
85_R	121_Y	0.630	0.15
28_Y	151_E	0.621	0.14
132_E	168_A	0.616	0.14
108_V	122_R	0.616	0.14
161_K	170_A	0.611	0.14
44_A	129_S	0.606	0.14
49_D	128_D	0.604	0.14
155_E	175_S	0.603	0.14
34_V	87_P	0.601	0.14
70_F	87_P	0.600	0.14
25_T	148_P	0.598	0.14
41_P	125_F	0.594	0.14
94_Q	128_D	0.590	0.14
104_T	177_G	0.586	0.14
29_E	101_H	0.585	0.14
38_T	105_D	0.585	0.14
52_R	168_A	0.584	0.14
29_E	104_T	0.583	0.14
25_T	132_E	0.578	0.13
106_E	169_F	0.573	0.13
69_G	84_R	0.570	0.13
28_Y	68_E	0.566	0.13
101_H	158_R	0.564	0.13
127_V	138_T	0.563	0.13
123_S	158_R	0.563	0.13
124_E	148_P	0.562	0.13
114_M	170_A	0.561	0.13
82_L	101_H	0.557	0.13
74_T	127_V	0.557	0.13
52_R	112_Q	0.554	0.13
59_R	154_P	0.552	0.13
128_D	152_I	0.549	0.13
107_L	125_F	0.549	0.13
32_R	80_G	0.544	0.13
99_L	179_A	0.538	0.13
104_T	110_R	0.536	0.13
59_R	172_A	0.534	0.13
86_S	90_L	0.534	0.13
153_D	156_T	0.532	0.12
108_V	121_Y	0.531	0.12
53_T	133_L	0.531	0.12
40_S	50_D	0.528	0.12
100_E	117_Q	0.528	0.12
136_N	156_T	0.528	0.12
72_E	103_S	0.519	0.12
126_G	164_R	0.519	0.12
70_F	130_P	0.514	0.12
114_M	128_D	0.514	0.12
126_G	162_T	0.512	0.12
35_V	122_R	0.511	0.12
27_P	64_T	0.505	0.12
95_A	104_T	0.505	0.12
55_P	130_P	0.503	0.12
68_E	154_P	0.502	0.12
52_R	82_L	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qbjA	1	0.3265	97.9	0.854	Contact Map
1r1uA	2	0.4847	97.7	0.859	Contact Map
2fu4A	2	0.3827	97.3	0.869	Contact Map
1qgpA	1	0.3776	97.3	0.87	Contact Map
1oyiA	1	0.3112	97.2	0.871	Contact Map
1sfuA	1	0.3469	97.2	0.871	Contact Map
3pqkA	2	0.5153	97.1	0.874	Contact Map
4g6qA	4	0.6735	97.1	0.874	Contact Map
3cuoA	2	0.5	96.9	0.878	Contact Map
2mh2A	1	0.3061	96.8	0.878	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.