Q9HHI8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHI8 - PhiH1 repressor homolog

UniProt:	Q9HHI8	Sequences: MRFDADWMSRADDRILEHLSEDGPDTPKEMADSDRVRFSRQHINARCKTLVEYGLLVHLGNGVYDITREGEQYLAGDLDARDLDPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	86 (81)
Sequences:	147 (107)
Seq/√Len:	11.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
47_C	56_L	4.738	1.00
19_L	56_L	4.287	1.00
13_D	73_Y	3.760	0.99
20_S	76_G	3.271	0.97
2_R	7_W	2.697	0.92
16_L	66_I	2.289	0.84
78_L	82_D	2.182	0.80
78_L	83_L	2.156	0.80
68_R	72_Q	1.965	0.73
24_P	31_A	1.793	0.65
31_A	43_I	1.669	0.60
68_R	71_E	1.594	0.56
32_D	60_G	1.590	0.56
48_K	60_G	1.565	0.55
57_V	67_T	1.520	0.52
80_A	83_L	1.485	0.51
28_K	82_D	1.429	0.48
52_E	81_R	1.416	0.47
11_A	38_F	1.379	0.45
2_R	5_A	1.353	0.44
28_K	32_D	1.144	0.34
9_S	18_H	1.120	0.33
18_H	25_D	1.119	0.33
20_S	75_A	1.115	0.33
54_G	75_A	1.095	0.32
4_D	10_R	1.093	0.32
14_R	66_I	1.059	0.30
29_E	43_I	1.059	0.30
18_H	32_D	1.055	0.30
23_G	56_L	1.042	0.30
27_P	82_D	1.023	0.29
43_I	58_H	1.021	0.29
4_D	14_R	1.009	0.28
47_C	71_E	1.004	0.28
5_A	83_L	0.999	0.28
39_S	59_L	0.995	0.28
42_H	47_C	0.988	0.28
13_D	17_E	0.988	0.28
22_D	47_C	0.972	0.27
69_E	77_D	0.955	0.26
38_F	76_G	0.946	0.26
14_R	44_N	0.944	0.26
21_E	49_T	0.942	0.26
14_R	39_S	0.942	0.26
25_D	65_D	0.935	0.25
13_D	32_D	0.927	0.25
55_L	78_L	0.912	0.25
11_A	37_R	0.904	0.24
24_P	43_I	0.900	0.24
30_M	63_V	0.867	0.23
68_R	79_D	0.850	0.22
24_P	59_L	0.849	0.22
16_L	30_M	0.844	0.22
31_A	40_R	0.832	0.22
36_V	82_D	0.822	0.21
2_R	6_D	0.818	0.21
69_E	72_Q	0.812	0.21
14_R	17_E	0.799	0.21
27_P	40_R	0.791	0.20
23_G	61_N	0.787	0.20
44_N	58_H	0.780	0.20
11_A	42_H	0.777	0.20
53_Y	83_L	0.770	0.20
24_P	63_V	0.755	0.19
72_Q	78_L	0.752	0.19
59_L	63_V	0.747	0.19
49_T	52_E	0.747	0.19
37_R	57_V	0.739	0.19
2_R	8_M	0.735	0.19
13_D	49_T	0.734	0.19
18_H	22_D	0.733	0.19
17_E	66_I	0.729	0.18
30_M	59_L	0.729	0.18
4_D	7_W	0.717	0.18
13_D	39_S	0.717	0.18
11_A	63_V	0.716	0.18
3_F	10_R	0.711	0.18
50_L	72_Q	0.699	0.18
25_D	59_L	0.692	0.17
32_D	75_A	0.685	0.17
32_D	36_V	0.683	0.17
80_A	84_D	0.677	0.17
66_I	73_Y	0.675	0.17
10_R	63_V	0.669	0.17
20_S	71_E	0.667	0.17
53_Y	80_A	0.662	0.17
68_R	82_D	0.661	0.17
25_D	66_I	0.657	0.16
22_D	25_D	0.654	0.16
10_R	18_H	0.653	0.16
30_M	38_F	0.652	0.16
6_D	14_R	0.650	0.16
57_V	71_E	0.648	0.16
15_I	24_P	0.639	0.16
26_T	76_G	0.632	0.16
21_E	65_D	0.621	0.15
11_A	45_A	0.620	0.15
52_E	57_V	0.617	0.15
13_D	71_E	0.590	0.15
77_D	83_L	0.590	0.15
79_D	83_L	0.579	0.14
43_I	76_G	0.577	0.14
4_D	39_S	0.576	0.14
26_T	78_L	0.573	0.14
30_M	37_R	0.572	0.14
53_Y	56_L	0.570	0.14
36_V	50_L	0.568	0.14
43_I	65_D	0.563	0.14
23_G	41_Q	0.560	0.14
32_D	53_Y	0.554	0.14
72_Q	75_A	0.553	0.14
71_E	78_L	0.552	0.14
2_R	17_E	0.541	0.13
38_F	42_H	0.535	0.13
2_R	13_D	0.534	0.13
5_A	76_G	0.534	0.13
14_R	40_R	0.529	0.13
18_H	47_C	0.518	0.13
44_N	61_N	0.508	0.13
21_E	40_R	0.505	0.13
9_S	36_V	0.500	0.13
22_D	40_R	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b73A	2	0.9651	99	0.681	Contact Map
1xmkA	1	0.8256	98.4	0.741	Contact Map
1r7jA	2	0.8953	98.4	0.743	Contact Map
2x4hA	3	0.8837	98.3	0.748	Contact Map
2nyxA	2	0.9767	98.2	0.757	Contact Map
3cdhA	4	0.9535	98.1	0.758	Contact Map
2fswA	2	0.9302	98.1	0.759	Contact Map
4mnuA	2	0.9535	98.1	0.759	Contact Map
1jgsA	2	0.9535	98.1	0.76	Contact Map
2wteA	2	0.907	98.1	0.76	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.