Q9HHI3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHI3 - Vng6381h

UniProt:	Q9HHI3	Sequences: MVGPGRKHPLTVGTIFWDMSAEPIATFESSLDEVGVELVRTTADEFASTLSPLLDAPTVGTSLPFETVSLPDSVETDPSIADLEAAATGVTAAGYGIADYGSVIIQGGTDGEEPVSLYADEHVAVVAASDVLPDMDATFDQLAEDIRNGVGQSIIATGPSATADMGALVTGAHGPMDVTVVLLEGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	186 (163)
Sequences:	3028 (2021)
Seq/√Len:	158.3

ECOLI - YKGG YKGF
BACSU - LUTC LUTB
HALSA - Q9HHI3 Q9HHI4
SULSO - Q97U90

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_L	36_V	3.694	1.00
48_S	52_P	2.903	1.00
31_L	180_V	2.792	1.00
28_E	32_D	2.779	1.00
52_P	56_A	2.756	1.00
102_S	155_I	2.745	1.00
96_G	126_V	2.669	1.00
134_D	137_A	2.612	1.00
91_T	122_H	2.356	1.00
102_S	157_T	2.286	1.00
54_L	88_T	2.262	1.00
59_V	88_T	2.259	1.00
42_T	45_E	2.219	1.00
27_F	96_G	2.215	1.00
19_M	22_E	2.213	1.00
88_T	123_V	2.210	1.00
57_P	177_D	2.150	1.00
39_V	49_T	2.134	1.00
60_G	87_A	2.045	1.00
39_V	179_T	2.025	1.00
120_D	176_M	2.013	1.00
28_E	40_R	1.952	1.00
30_S	33_E	1.920	1.00
36_V	178_V	1.908	1.00
27_F	180_V	1.880	1.00
27_F	31_L	1.865	1.00
93_A	96_G	1.858	1.00
37_E	179_T	1.790	1.00
121_E	177_D	1.766	1.00
31_L	178_V	1.740	1.00
45_E	48_S	1.720	1.00
127_A	130_D	1.711	1.00
87_A	120_D	1.626	1.00
121_E	179_T	1.558	1.00
29_S	32_D	1.544	1.00
93_A	124_A	1.529	1.00
104_I	155_I	1.521	1.00
26_T	29_S	1.520	1.00
25_A	29_S	1.512	1.00
125_V	183_L	1.499	1.00
89_G	119_A	1.489	1.00
41_T	181_V	1.475	1.00
93_A	130_D	1.464	1.00
49_T	53_L	1.454	1.00
88_T	121_E	1.453	1.00
26_T	30_S	1.449	1.00
128_A	182_L	1.449	1.00
131_V	182_L	1.447	1.00
93_A	126_V	1.430	1.00
22_E	25_A	1.429	1.00
41_T	49_T	1.418	1.00
36_V	180_V	1.409	1.00
133_P	137_A	1.392	1.00
23_P	133_P	1.389	1.00
103_V	124_A	1.346	1.00
28_E	38_L	1.340	1.00
81_A	85_A	1.332	1.00
57_P	121_E	1.316	1.00
40_R	128_A	1.299	1.00
40_R	184_E	1.274	1.00
24_I	131_V	1.260	1.00
123_V	181_V	1.246	1.00
37_E	177_D	1.224	1.00
89_G	115_V	1.215	1.00
69_S	73_S	1.203	1.00
95_Y	132_L	1.203	1.00
59_V	87_A	1.187	1.00
126_V	182_L	1.176	1.00
103_V	178_V	1.176	1.00
65_F	70_L	1.175	1.00
62_S	90_V	1.133	1.00
49_T	52_P	1.116	1.00
44_D	48_S	1.107	1.00
24_I	28_E	1.102	1.00
24_I	182_L	1.060	0.99
61_T	87_A	1.039	0.99
95_Y	138_T	1.033	0.99
68_V	72_D	1.019	0.99
162_T	165_M	1.011	0.99
69_S	72_D	1.005	0.99
51_S	55_D	0.990	0.99
160_S	173_H	0.989	0.99
67_T	70_L	0.955	0.99
83_L	118_Y	0.952	0.99
128_A	184_E	0.948	0.99
160_S	164_D	0.946	0.98
39_V	53_L	0.943	0.98
41_T	45_E	0.940	0.98
29_S	33_E	0.938	0.98
25_A	40_R	0.937	0.98
49_T	181_V	0.937	0.98
34_V	157_T	0.914	0.98
16_F	23_P	0.909	0.98
116_S	156_A	0.908	0.98
79_S	82_D	0.890	0.98
82_D	85_A	0.883	0.98
34_V	161_A	0.874	0.97
70_L	73_S	0.868	0.97
53_L	121_E	0.850	0.97
99_D	134_D	0.846	0.97
160_S	165_M	0.846	0.97
41_T	46_F	0.837	0.97
55_D	58_T	0.831	0.97
92_A	127_A	0.820	0.96
20_S	24_I	0.817	0.96
68_V	71_P	0.800	0.96
47_A	50_L	0.795	0.96
94_G	106_Q	0.794	0.96
43_A	127_A	0.791	0.95
104_I	138_T	0.786	0.95
54_L	123_V	0.784	0.95
27_F	131_V	0.780	0.95
50_L	123_V	0.771	0.95
91_T	116_S	0.767	0.95
23_P	131_V	0.766	0.95
50_L	125_V	0.766	0.95
50_L	181_V	0.764	0.95
113_E	116_S	0.763	0.95
117_L	152_Q	0.761	0.94
32_D	40_R	0.758	0.94
113_E	156_A	0.756	0.94
158_G	174_G	0.756	0.94
165_M	173_H	0.752	0.94
24_I	128_A	0.749	0.94
61_T	64_P	0.748	0.94
59_V	121_E	0.747	0.94
160_S	163_A	0.746	0.94
161_A	164_D	0.740	0.94
45_E	49_T	0.738	0.93
24_I	40_R	0.732	0.93
32_D	37_E	0.730	0.93
39_V	52_P	0.730	0.93
27_F	30_S	0.726	0.93
46_F	183_L	0.720	0.93
156_A	160_S	0.713	0.92
46_F	125_V	0.708	0.92
126_V	180_V	0.706	0.92
135_M	155_I	0.705	0.92
143_A	146_I	0.702	0.92
19_M	23_P	0.698	0.91
90_V	125_V	0.696	0.91
139_F	155_I	0.696	0.91
76_T	79_S	0.693	0.91
38_L	182_L	0.691	0.91
65_F	69_S	0.689	0.91
46_F	50_L	0.685	0.91
66_E	69_S	0.683	0.91
114_P	117_L	0.682	0.91
54_L	59_V	0.673	0.90
20_S	23_P	0.669	0.90
56_A	177_D	0.664	0.89
26_T	98_A	0.661	0.89
65_F	71_P	0.659	0.89
89_G	116_S	0.657	0.89
34_V	158_G	0.657	0.89
61_T	82_D	0.656	0.89
102_S	135_M	0.655	0.89
100_Y	157_T	0.654	0.89
164_D	175_P	0.651	0.88
83_L	172_A	0.645	0.88
16_F	19_M	0.641	0.88
107_G	112_E	0.640	0.88
43_A	47_A	0.637	0.87
30_S	35_G	0.635	0.87
142_L	153_S	0.634	0.87
92_A	130_D	0.633	0.87
162_T	172_A	0.632	0.87
147_R	150_V	0.631	0.87
51_S	54_L	0.630	0.87
25_A	28_E	0.630	0.87
160_S	174_G	0.629	0.87
104_I	153_S	0.628	0.87
44_D	47_A	0.626	0.86
93_A	103_V	0.612	0.85
84_E	118_Y	0.609	0.85
96_G	130_D	0.608	0.85
158_G	175_P	0.605	0.84
97_I	135_M	0.602	0.84
61_T	85_A	0.601	0.84
116_S	122_H	0.598	0.84
99_D	136_D	0.596	0.84
91_T	111_G	0.596	0.84
94_G	130_D	0.596	0.84
49_T	179_T	0.595	0.84
95_Y	104_I	0.590	0.83
78_P	81_A	0.589	0.83
144_E	153_S	0.586	0.83
52_P	55_D	0.586	0.83
97_I	132_L	0.584	0.82
75_E	79_S	0.583	0.82
113_E	117_L	0.583	0.82
75_E	78_P	0.581	0.82
172_A	175_P	0.579	0.82
31_L	96_G	0.573	0.81
58_T	87_A	0.568	0.81
98_A	131_V	0.565	0.80
18_D	22_E	0.563	0.80
60_G	63_L	0.563	0.80
162_T	173_H	0.559	0.80
164_D	174_G	0.558	0.79
53_L	56_A	0.556	0.79
94_G	108_G	0.554	0.79
161_A	175_P	0.552	0.79
164_D	173_H	0.551	0.79
34_V	129_S	0.547	0.78
100_Y	113_E	0.547	0.78
16_F	22_E	0.545	0.78
83_L	86_A	0.542	0.77
75_E	80_I	0.542	0.77
94_G	111_G	0.541	0.77
97_I	134_D	0.541	0.77
155_I	159_P	0.540	0.77
63_L	86_A	0.539	0.77
132_L	141_Q	0.538	0.77
111_G	154_I	0.537	0.77
67_T	72_D	0.536	0.77
158_G	161_A	0.536	0.77
140_D	144_E	0.535	0.77
28_E	182_L	0.534	0.76
132_L	138_T	0.534	0.76
58_T	64_P	0.533	0.76
53_L	179_T	0.531	0.76
58_T	62_S	0.528	0.76
117_L	164_D	0.527	0.75
158_G	165_M	0.526	0.75
120_D	161_A	0.526	0.75
151_G	159_P	0.525	0.75
31_L	38_L	0.523	0.75
65_F	68_V	0.522	0.75
119_A	163_A	0.520	0.75
43_A	184_E	0.517	0.74
144_E	151_G	0.516	0.74
162_T	174_G	0.510	0.73
157_T	161_A	0.509	0.73
179_T	182_L	0.508	0.73
138_T	141_Q	0.508	0.73
102_S	153_S	0.507	0.73
95_Y	139_F	0.507	0.73
25_A	32_D	0.507	0.73
156_A	162_T	0.506	0.73
97_I	138_T	0.505	0.72
108_G	146_I	0.504	0.72
100_Y	155_I	0.503	0.72
107_G	154_I	0.500	0.72

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2g40A	2	0.8333	100	0.238	Contact Map
3cf4A	2	0.7903	95.1	0.884	Contact Map
4mijA	1	0.4086	34.8	0.937	Contact Map
4mncA	1	0.4462	20.1	0.944	Contact Map
3brcA	4	0.7742	20.1	0.944	Contact Map
4pbhA	1	0.4409	18.9	0.945	Contact Map
1yksA	1	0.4785	18.7	0.945	Contact Map
4o8mA	4	0.3548	15.9	0.946	Contact Map
4ng7A	1	0.3871	15.6	0.947	Contact Map
3al0C	1	0.6828	14.5	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.