Q9HHH1 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHH1 - Vng6402h

UniProt:	Q9HHH1	Sequences: MAETGDDVNEQVKADWQDDTTPFERVYEIVEQTHDGQSAAEIADRALVSEPTARRHCKALVNTGFAETEQDGQTTLYKRNSDRVLMSRIRELREEVDRPELLDSIQDMKAEIRRYEDRYNVVSPEELAQQLEAGETDGWDDLTAWRTTRQNLAVAQAALAYDEASHQLAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	170 (149)
Sequences:	199 (146)
Seq/√Len:	12.0

HALSA - Q9HHH1 Q9HHK1 Q9HHH4 O51987

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_V	66_A	4.258	1.00
116_E	122_V	2.659	0.92
26_V	49_S	2.632	0.91
108_M	148_T	2.592	0.91
121_V	142_L	2.334	0.85
103_D	119_Y	2.312	0.85
92_L	101_L	2.258	0.83
56_H	60_L	2.120	0.79
119_Y	141_D	2.102	0.78
105_I	152_L	1.972	0.73
109_K	152_L	1.935	0.72
151_N	155_A	1.896	0.70
80_N	86_M	1.868	0.69
24_E	157_A	1.863	0.69
118_R	121_V	1.826	0.67
22_P	49_S	1.768	0.65
127_L	142_L	1.766	0.65
33_T	105_I	1.737	0.63
17_Q	47_L	1.729	0.63
61_V	107_D	1.701	0.62
117_D	125_E	1.690	0.61
23_F	56_H	1.674	0.60
23_F	60_L	1.673	0.60
114_R	121_V	1.669	0.60
84_V	92_L	1.608	0.57
49_S	52_T	1.604	0.57
107_D	120_N	1.598	0.57
49_S	60_L	1.589	0.56
118_R	126_E	1.585	0.56
83_R	87_S	1.584	0.56
86_M	93_R	1.583	0.56
52_T	56_H	1.575	0.55
114_R	117_D	1.568	0.55
99_P	117_D	1.558	0.55
26_V	34_H	1.539	0.54
35_D	41_E	1.511	0.52
110_A	133_A	1.483	0.51
84_V	142_L	1.463	0.50
54_R	124_P	1.452	0.49
63_T	83_R	1.445	0.49
120_N	129_Q	1.442	0.49
116_E	123_S	1.396	0.47
21_T	55_R	1.379	0.46
68_T	89_I	1.377	0.46
44_D	47_L	1.363	0.45
42_I	97_D	1.352	0.44
26_V	60_L	1.333	0.43
71_D	142_L	1.295	0.42
36_G	77_Y	1.291	0.41
88_R	139_W	1.270	0.40
30_V	33_T	1.263	0.40
44_D	107_D	1.263	0.40
61_V	133_A	1.261	0.40
27_Y	85_L	1.260	0.40
117_D	120_N	1.252	0.39
72_G	126_E	1.251	0.39
117_D	137_D	1.244	0.39
97_D	100_E	1.229	0.38
48_V	52_T	1.191	0.37
61_V	66_A	1.177	0.36
26_V	59_A	1.174	0.36
44_D	160_A	1.167	0.35
55_R	58_K	1.155	0.35
97_D	134_G	1.099	0.32
145_W	158_A	1.097	0.32
54_R	88_R	1.091	0.32
110_A	121_V	1.086	0.32
64_G	79_R	1.057	0.31
36_G	115_Y	1.041	0.30
83_R	86_M	1.037	0.30
18_D	113_R	1.013	0.29
22_P	127_L	1.012	0.29
32_Q	162_D	1.011	0.29
115_Y	141_D	0.997	0.28
86_M	108_M	0.996	0.28
103_D	110_A	0.993	0.28
86_M	127_L	0.983	0.28
120_N	125_E	0.983	0.28
32_Q	86_M	0.982	0.28
48_V	119_Y	0.976	0.27
39_A	116_E	0.968	0.27
80_N	127_L	0.961	0.27
82_D	115_Y	0.958	0.27
79_R	84_V	0.955	0.26
26_V	136_T	0.950	0.26
113_R	134_G	0.946	0.26
84_V	127_L	0.942	0.26
110_A	130_Q	0.940	0.26
29_I	60_L	0.939	0.26
136_T	146_R	0.938	0.26
118_R	141_D	0.937	0.26
119_Y	140_D	0.935	0.26
72_G	111_E	0.926	0.25
37_Q	80_N	0.919	0.25
19_D	135_E	0.916	0.25
106_Q	138_G	0.916	0.25
105_I	139_W	0.908	0.25
110_A	118_R	0.902	0.24
79_R	128_A	0.899	0.24
130_Q	140_D	0.893	0.24
65_F	83_R	0.892	0.24
23_F	55_R	0.890	0.24
50_E	54_R	0.880	0.24
21_T	26_V	0.870	0.23
38_S	76_L	0.868	0.23
112_I	152_L	0.865	0.23
112_I	148_T	0.865	0.23
100_E	122_V	0.863	0.23
44_D	122_V	0.862	0.23
21_T	38_S	0.856	0.23
132_E	143_T	0.841	0.22
54_R	79_R	0.835	0.22
97_D	129_Q	0.835	0.22
107_D	125_E	0.832	0.22
32_Q	132_E	0.831	0.22
79_R	115_Y	0.829	0.22
26_V	47_L	0.829	0.22
25_R	49_S	0.828	0.22
132_E	152_L	0.826	0.22
56_H	59_A	0.818	0.21
43_A	53_A	0.817	0.21
123_S	126_E	0.815	0.21
31_E	76_L	0.813	0.21
79_R	142_L	0.793	0.21
65_F	117_D	0.793	0.21
19_D	80_N	0.792	0.21
23_F	51_P	0.792	0.21
21_T	24_E	0.788	0.20
108_M	155_A	0.784	0.20
101_L	118_R	0.783	0.20
102_L	116_E	0.778	0.20
103_D	131_L	0.771	0.20
46_A	137_D	0.769	0.20
88_R	122_V	0.765	0.20
25_R	48_V	0.758	0.19
24_E	52_T	0.750	0.19
80_N	83_R	0.748	0.19
59_A	82_D	0.747	0.19
35_D	150_Q	0.731	0.19
48_V	90_R	0.727	0.19
89_I	92_L	0.724	0.18
104_S	151_N	0.715	0.18
58_K	135_E	0.715	0.18
101_L	149_R	0.707	0.18
21_T	25_R	0.706	0.18
31_E	85_L	0.705	0.18
140_D	158_A	0.704	0.18
146_R	162_D	0.701	0.18
74_T	83_R	0.699	0.18
128_A	162_D	0.695	0.18
74_T	127_L	0.694	0.18
126_E	153_A	0.692	0.17
150_Q	157_A	0.686	0.17
56_H	91_E	0.684	0.17
24_E	39_A	0.681	0.17
106_Q	142_L	0.676	0.17
54_R	147_T	0.674	0.17
58_K	94_E	0.674	0.17
98_R	162_D	0.673	0.17
51_P	160_A	0.670	0.17
17_Q	143_T	0.668	0.17
74_T	155_A	0.667	0.17
34_H	93_R	0.666	0.17
77_Y	112_I	0.666	0.17
39_A	118_R	0.660	0.17
62_N	67_E	0.658	0.17
24_E	58_K	0.656	0.16
27_Y	74_T	0.653	0.16
37_Q	127_L	0.651	0.16
112_I	116_E	0.648	0.16
140_D	160_A	0.645	0.16
72_G	120_N	0.644	0.16
148_T	152_L	0.638	0.16
42_I	48_V	0.637	0.16
29_I	81_S	0.635	0.16
28_E	128_A	0.634	0.16
66_A	108_M	0.631	0.16
139_W	155_A	0.624	0.16
47_L	100_E	0.623	0.16
85_L	159_L	0.623	0.16
41_E	114_R	0.622	0.16
87_S	151_N	0.619	0.15
66_A	138_G	0.618	0.15
44_D	136_T	0.605	0.15
80_N	84_V	0.604	0.15
47_L	50_E	0.598	0.15
56_H	89_I	0.598	0.15
64_G	78_K	0.593	0.15
21_T	156_Q	0.587	0.15
111_E	144_A	0.584	0.15
116_E	137_D	0.583	0.15
30_V	116_E	0.578	0.14
44_D	110_A	0.573	0.14
107_D	132_E	0.569	0.14
130_Q	141_D	0.566	0.14
59_A	88_R	0.563	0.14
29_I	99_P	0.560	0.14
86_M	90_R	0.558	0.14
67_E	99_P	0.556	0.14
48_V	53_A	0.555	0.14
67_E	78_K	0.552	0.14
45_R	88_R	0.551	0.14
18_D	95_E	0.549	0.14
93_R	162_D	0.546	0.14
117_D	133_A	0.545	0.14
16_W	20_T	0.544	0.14
118_R	135_E	0.542	0.14
80_N	85_L	0.537	0.13
16_W	56_H	0.536	0.13
37_Q	41_E	0.534	0.13
110_A	132_E	0.533	0.13
54_R	157_A	0.533	0.13
22_P	60_L	0.531	0.13
54_R	139_W	0.529	0.13
82_D	155_A	0.528	0.13
124_P	149_R	0.526	0.13
65_F	124_P	0.521	0.13
146_R	155_A	0.519	0.13
117_D	122_V	0.515	0.13
62_N	114_R	0.511	0.13
81_S	85_L	0.511	0.13
84_V	112_I	0.511	0.13
48_V	127_L	0.510	0.13
23_F	39_A	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qbjA	1	0.3765	97.9	0.843	Contact Map
1qgpA	1	0.4353	97.4	0.857	Contact Map
1sfuA	1	0.4	97.4	0.858	Contact Map
1oyiA	1	0.3588	97.4	0.858	Contact Map
1r1uA	2	0.5353	97.2	0.861	Contact Map
2fu4A	2	0.4294	97.1	0.865	Contact Map
4g6qA	4	0.7647	96.9	0.867	Contact Map
3pqkA	2	0.5824	96.9	0.868	Contact Map
2mh2A	1	0.3529	96.8	0.869	Contact Map
2p4wA	2	0.9353	96.8	0.87	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.