Q9HHE7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHE7 - Vng6441h

UniProt:	Q9HHE7	Sequences: MSLFMGCHGIPLGCAHTKNMKKVTLEIPDRDERGVSPVIGVILMVAITVILAAVIASFVLGFGGSVNETVQAGADVSENGDGTATVTWISEGTASELEVSVEGVDGNVTLDQVGDSATIQYNSDTDSDNKIDDDDNTITATDDGDGNDPGEVTLQVTVTGIGSEDTRTVIAQEEVTLENQNN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (146)
Sequences:	105 (102)
Seq/√Len:	8.4

HALSA - Q9HHE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
70_V	91_E	3.389	0.94
88_W	91_E	3.172	0.91
70_V	88_W	2.915	0.87
26_E	61_G	2.892	0.87
28_P	61_G	2.669	0.82
28_P	57_S	2.503	0.78
61_G	65_S	2.396	0.74
62_F	163_S	2.342	0.73
42_I	50_I	2.145	0.66
42_I	55_I	2.099	0.64
39_I	50_I	2.018	0.61
157_T	164_E	1.976	0.59
54_V	59_V	1.920	0.57
56_A	89_I	1.842	0.53
28_P	32_E	1.831	0.53
70_V	94_A	1.818	0.52
46_A	51_L	1.783	0.51
26_E	29_D	1.745	0.49
51_L	63_G	1.735	0.49
91_E	94_A	1.718	0.48
163_S	167_R	1.700	0.47
88_W	94_A	1.668	0.46
27_I	61_G	1.635	0.45
44_M	55_I	1.617	0.44
88_W	92_G	1.605	0.43
62_F	65_S	1.605	0.43
50_I	55_I	1.605	0.43
55_I	59_V	1.598	0.43
50_I	59_V	1.593	0.43
76_V	84_A	1.556	0.41
44_M	59_V	1.515	0.40
62_F	67_N	1.449	0.37
39_I	54_V	1.423	0.36
54_V	63_G	1.409	0.36
26_E	57_S	1.401	0.35
71_Q	87_T	1.397	0.35
88_W	97_L	1.383	0.35
62_F	87_T	1.338	0.33
42_I	62_F	1.329	0.33
69_T	91_E	1.323	0.32
58_F	72_A	1.310	0.32
70_V	73_G	1.304	0.32
91_E	169_V	1.290	0.31
73_G	91_E	1.279	0.31
93_T	97_L	1.270	0.30
77_S	113_V	1.266	0.30
39_I	55_I	1.249	0.30
57_S	98_E	1.245	0.29
98_E	163_S	1.238	0.29
166_T	169_V	1.227	0.29
39_I	59_V	1.227	0.29
90_S	161_I	1.222	0.29
61_G	70_V	1.208	0.28
35_V	41_V	1.183	0.27
84_A	154_L	1.181	0.27
157_T	163_S	1.172	0.27
159_T	170_I	1.172	0.27
42_I	47_I	1.172	0.27
57_S	61_G	1.169	0.27
38_V	53_A	1.163	0.27
45_V	53_A	1.163	0.27
38_V	45_V	1.163	0.27
105_D	122_N	1.150	0.26
70_V	92_G	1.142	0.26
121_Y	124_D	1.133	0.26
56_A	158_V	1.129	0.26
46_A	63_G	1.128	0.26
86_V	97_L	1.107	0.25
74_A	87_T	1.093	0.24
135_D	153_T	1.088	0.24
27_I	33_R	1.078	0.24
51_L	58_F	1.075	0.24
155_Q	167_R	1.049	0.23
73_G	94_A	1.046	0.23
159_T	164_E	1.043	0.23
65_S	75_D	1.028	0.22
90_S	102_E	1.025	0.22
28_P	33_R	1.025	0.22
60_L	65_S	1.017	0.22
75_D	89_I	1.003	0.22
37_P	49_V	1.002	0.22
46_A	72_A	0.993	0.21
136_N	142_D	0.991	0.21
128_D	137_T	0.987	0.21
30_R	86_V	0.981	0.21
103_G	136_N	0.978	0.21
119_I	141_T	0.960	0.21
87_T	167_R	0.958	0.20
29_D	84_A	0.956	0.20
50_I	54_V	0.955	0.20
69_T	88_W	0.944	0.20
73_G	88_W	0.941	0.20
33_R	78_E	0.940	0.20
28_P	76_V	0.936	0.20
88_W	169_V	0.933	0.20
30_R	57_S	0.926	0.20
32_E	57_S	0.912	0.19
82_G	148_D	0.907	0.19
129_N	144_G	0.906	0.19
83_T	148_D	0.905	0.19
74_A	167_R	0.902	0.19
105_D	147_N	0.900	0.19
81_D	123_S	0.895	0.19
63_G	72_A	0.887	0.19
67_N	162_G	0.883	0.19
92_G	170_I	0.877	0.18
70_V	97_L	0.874	0.18
42_I	72_A	0.866	0.18
51_L	54_V	0.860	0.18
74_A	94_A	0.855	0.18
33_R	61_G	0.855	0.18
133_D	138_I	0.841	0.17
70_V	169_V	0.830	0.17
77_S	89_I	0.817	0.17
55_I	62_F	0.815	0.17
86_V	134_D	0.803	0.17
88_W	166_T	0.803	0.17
70_V	156_V	0.798	0.16
119_I	123_S	0.780	0.16
133_D	139_T	0.780	0.16
74_A	91_E	0.780	0.16
89_I	164_E	0.779	0.16
106_G	112_Q	0.772	0.16
134_D	140_A	0.767	0.16
96_E	157_T	0.766	0.16
90_S	164_E	0.765	0.16
114_G	121_Y	0.765	0.16
31_D	95_S	0.752	0.15
116_S	153_T	0.751	0.15
84_A	150_G	0.749	0.15
52_A	72_A	0.744	0.15
83_T	107_N	0.742	0.15
80_G	85_T	0.740	0.15
153_T	162_G	0.739	0.15
56_A	61_G	0.733	0.15
115_D	151_E	0.720	0.15
134_D	138_I	0.714	0.15
90_S	159_T	0.711	0.15
42_I	52_A	0.709	0.14
64_G	87_T	0.706	0.14
42_I	46_A	0.704	0.14
93_T	170_I	0.697	0.14
137_T	140_A	0.696	0.14
51_L	72_A	0.695	0.14
66_V	162_G	0.694	0.14
41_V	46_A	0.692	0.14
80_G	116_S	0.687	0.14
64_G	96_E	0.687	0.14
60_L	64_G	0.685	0.14
50_I	62_F	0.685	0.14
79_N	111_D	0.677	0.14
120_Q	123_S	0.667	0.14
125_T	135_D	0.667	0.14
127_S	139_T	0.664	0.14
126_D	141_T	0.653	0.13
84_A	155_Q	0.652	0.13
56_A	164_E	0.650	0.13
71_Q	153_T	0.647	0.13
60_L	71_Q	0.644	0.13
113_V	124_D	0.638	0.13
134_D	142_D	0.637	0.13
139_T	142_D	0.637	0.13
111_D	147_N	0.637	0.13
105_D	124_D	0.637	0.13
80_G	130_K	0.636	0.13
101_V	123_S	0.631	0.13
130_K	133_D	0.624	0.13
47_I	58_F	0.623	0.13
100_S	132_D	0.621	0.13
85_T	96_E	0.619	0.13
164_E	170_I	0.618	0.13
44_M	54_V	0.618	0.13
105_D	121_Y	0.613	0.13
75_D	143_D	0.609	0.13
27_I	30_R	0.609	0.13
116_S	120_Q	0.605	0.12
135_D	138_I	0.604	0.12
77_S	122_N	0.598	0.12
74_A	158_V	0.594	0.12
61_G	167_R	0.594	0.12
82_G	97_L	0.594	0.12
61_G	73_G	0.593	0.12
46_A	52_A	0.592	0.12
74_A	78_E	0.591	0.12
44_M	50_I	0.589	0.12
155_Q	168_T	0.588	0.12
104_V	146_G	0.584	0.12
101_V	137_T	0.573	0.12
112_Q	117_A	0.569	0.12
39_I	49_V	0.568	0.12
29_D	33_R	0.561	0.12
113_V	116_S	0.556	0.12
108_V	139_T	0.552	0.12
65_S	78_E	0.544	0.11
85_T	107_N	0.537	0.11
57_S	66_V	0.537	0.11
111_D	117_A	0.535	0.11
82_G	149_P	0.534	0.11
30_R	162_G	0.534	0.11
81_D	120_Q	0.533	0.11
33_R	89_I	0.530	0.11
58_F	63_G	0.528	0.11
76_V	154_L	0.528	0.11
124_D	132_D	0.528	0.11
119_I	138_I	0.527	0.11
69_T	74_A	0.523	0.11
114_G	120_Q	0.523	0.11
114_G	130_K	0.520	0.11
104_V	150_G	0.512	0.11
47_I	60_L	0.511	0.11
112_Q	120_Q	0.510	0.11
134_D	137_T	0.509	0.11
29_D	65_S	0.506	0.11
56_A	63_G	0.503	0.11
87_T	94_A	0.503	0.11
44_M	63_G	0.502	0.11
138_I	141_T	0.502	0.11
123_S	143_D	0.500	0.11
75_D	168_T	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4l9dA	1	0.4505	14.1	0.961	Contact Map
3j1rA	5	0.1429	13.3	0.961	Contact Map
2bs2C	2	0.3956	10.2	0.963	Contact Map
1to2I	1	0.2143	8.1	0.965	Contact Map
2ci2I	3	0.2143	6.7	0.966	Contact Map
1mitA	1	0.2143	6.4	0.967	Contact Map
1dwmA	1	0.2198	5.9	0.967	Contact Map
1cseI	1	0.2143	5.2	0.968	Contact Map
4peuA	1	0.5879	5.2	0.968	Contact Map
1vbwA	1	0.2143	5.2	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.