Q9HHE2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HHE2 - Vng6048h

UniProt:	Q9HHE2	Sequences: MHDLTGFQRDILYVIADFEEPHGLALKDELEVYYEQEINHGRLYPNLDDLVDKGLVEKGELDERTNSYTLTQRGHREITARRDWEQQYVDLSE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (87)
Sequences:	293 (129)
Seq/√Len:	13.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_R	85_E	2.835	0.96
41_G	45_P	2.753	0.95
81_R	85_E	2.440	0.91
73_R	77_E	2.338	0.89
40_H	43_L	2.315	0.89
38_I	52_D	2.250	0.87
24_L	30_L	2.019	0.81
61_L	67_S	2.010	0.80
31_E	38_I	1.918	0.77
22_H	25_A	1.870	0.75
6_G	9_R	1.773	0.71
59_G	67_S	1.726	0.69
15_I	28_D	1.700	0.68
45_P	58_K	1.694	0.68
73_R	76_R	1.668	0.66
53_K	76_R	1.628	0.64
21_P	67_S	1.622	0.64
5_T	74_G	1.614	0.64
6_G	10_D	1.609	0.63
35_E	48_D	1.588	0.62
45_P	74_G	1.561	0.61
5_T	42_R	1.555	0.61
41_G	58_K	1.552	0.60
16_A	26_L	1.526	0.59
29_E	41_G	1.323	0.48
5_T	8_Q	1.309	0.48
38_I	73_R	1.277	0.46
60_E	72_Q	1.270	0.45
19_E	87_Q	1.244	0.44
15_I	21_P	1.229	0.43
15_I	70_L	1.227	0.43
2_H	74_G	1.222	0.43
17_D	21_P	1.215	0.42
58_K	84_W	1.212	0.42
22_H	30_L	1.195	0.41
10_D	81_R	1.185	0.41
13_Y	81_R	1.184	0.41
17_D	85_E	1.163	0.40
29_E	80_A	1.152	0.39
45_P	48_D	1.143	0.39
4_L	8_Q	1.126	0.38
22_H	61_L	1.101	0.37
54_G	73_R	1.068	0.35
33_Y	84_W	1.043	0.34
81_R	84_W	1.037	0.33
3_D	87_Q	1.018	0.33
9_R	49_D	0.996	0.32
8_Q	27_K	0.977	0.31
29_E	55_L	0.975	0.31
56_V	75_H	0.972	0.30
39_N	63_E	0.970	0.30
49_D	53_K	0.904	0.27
74_G	79_T	0.902	0.27
15_I	56_V	0.884	0.27
77_E	80_A	0.879	0.26
56_V	79_T	0.867	0.26
3_D	85_E	0.867	0.26
6_G	21_P	0.862	0.26
2_H	35_E	0.861	0.26
53_K	88_Y	0.859	0.26
45_P	49_D	0.850	0.25
34_Y	38_I	0.828	0.24
7_F	64_R	0.826	0.24
34_Y	39_N	0.797	0.23
58_K	66_N	0.785	0.23
38_I	59_G	0.784	0.23
39_N	62_D	0.777	0.22
43_L	62_D	0.776	0.22
3_D	40_H	0.773	0.22
48_D	83_D	0.768	0.22
82_R	86_Q	0.759	0.22
11_I	37_E	0.748	0.21
23_G	66_N	0.746	0.21
48_D	74_G	0.745	0.21
68_Y	71_T	0.737	0.21
9_R	21_P	0.734	0.21
11_I	49_D	0.734	0.21
33_Y	71_T	0.728	0.21
41_G	65_T	0.726	0.20
13_Y	85_E	0.726	0.20
29_E	33_Y	0.725	0.20
14_V	71_T	0.725	0.20
51_V	56_V	0.715	0.20
4_L	31_E	0.715	0.20
3_D	34_Y	0.709	0.20
80_A	85_E	0.708	0.20
20_E	56_V	0.705	0.20
58_K	81_R	0.704	0.20
40_H	62_D	0.703	0.20
45_P	60_E	0.666	0.18
19_E	26_L	0.665	0.18
42_R	55_L	0.660	0.18
5_T	46_N	0.660	0.18
54_G	70_L	0.658	0.18
29_E	53_K	0.653	0.18
54_G	80_A	0.649	0.18
51_V	65_T	0.649	0.18
10_D	17_D	0.647	0.18
41_G	66_N	0.628	0.17
35_E	78_I	0.625	0.17
16_A	72_Q	0.618	0.17
61_L	75_H	0.615	0.17
13_Y	17_D	0.614	0.17
9_R	12_L	0.612	0.17
47_L	65_T	0.604	0.16
22_H	59_G	0.602	0.16
40_H	55_L	0.602	0.16
79_T	83_D	0.596	0.16
55_L	77_E	0.590	0.16
41_G	51_V	0.590	0.16
51_V	58_K	0.571	0.16
13_Y	67_S	0.570	0.16
20_E	30_L	0.569	0.15
78_I	86_Q	0.567	0.15
24_L	34_Y	0.567	0.15
11_I	46_N	0.566	0.15
31_E	49_D	0.566	0.15
23_G	64_R	0.558	0.15
27_K	63_E	0.554	0.15
9_R	15_I	0.550	0.15
45_P	63_E	0.530	0.14
10_D	13_Y	0.529	0.14
13_Y	84_W	0.528	0.14
24_L	62_D	0.508	0.14
51_V	81_R	0.508	0.14
21_P	78_I	0.506	0.14
17_D	88_Y	0.505	0.14
9_R	79_T	0.504	0.14
51_V	83_D	0.501	0.14
48_D	60_E	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2co5A	2	0.9785	98.8	0.744	Contact Map
3l9fA	2	0.9032	98.6	0.762	Contact Map
1yg2A	2	0.8495	98.4	0.775	Contact Map
3elkA	3	0.9355	98.3	0.78	Contact Map
2e1nA	2	0.9677	98.3	0.78	Contact Map
3f8bA	2	0.9677	98.3	0.78	Contact Map
1xmaA	2	0.9462	98.3	0.78	Contact Map
2zfwA	2	0.9677	98.3	0.781	Contact Map
2eshA	2	0.9785	98.3	0.783	Contact Map
2dqlA	2	0.957	98.1	0.79	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.