RL18 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL18 - 50S ribosomal protein L18

UniProt:	P50562	Sequences: MATGPRYKVPMRRRREVRTDYHQRLRLLKSGKPRLVARKSNKHVTAQLVTTGPDGDETVASAHSSDLDAYGWAAPTGNLPAAYLTGLLAGQRAVDAGVEEAVLDIGLNTATPGSKVFAIQEGAIDAGLDVPHNDSVLADWSRTRGEHIAEYAESLDEPLYSGDFDATALPAHFDETREAIMED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	183 (181)
Sequences:	485 (244)
Seq/√Len:	18.1

HALSA - RL18
SULSO - RL18

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_S	45_T	7.283	1.00
90_G	126_A	4.520	1.00
46_A	119_I	4.431	1.00
49_V	58_T	3.716	1.00
36_V	49_V	3.383	1.00
72_W	176_T	3.232	0.99
12_R	16_E	2.971	0.99
43_H	65_S	2.791	0.98
46_A	89_A	2.755	0.98
44_V	82_A	2.558	0.97
101_A	134_D	2.494	0.96
110_A	117_F	2.484	0.96
159_L	163_D	2.453	0.96
172_H	176_T	2.299	0.94
175_E	179_A	2.273	0.94
22_H	25_L	2.265	0.94
103_L	120_Q	2.177	0.92
43_H	63_H	2.162	0.92
35_L	123_A	2.132	0.91
85_T	88_L	2.079	0.90
35_L	89_A	2.052	0.90
64_S	85_T	2.040	0.89
171_A	175_E	1.979	0.88
171_A	182_E	1.941	0.87
123_A	128_L	1.851	0.84
80_P	148_I	1.839	0.84
62_A	66_D	1.815	0.83
74_A	172_H	1.756	0.81
142_R	146_E	1.755	0.81
107_L	117_F	1.755	0.81
100_E	129_D	1.713	0.79
48_L	128_L	1.675	0.77
20_D	23_Q	1.659	0.77
37_A	138_A	1.523	0.70
120_Q	132_H	1.516	0.70
111_T	114_S	1.505	0.69
177_R	181_M	1.499	0.69
3_T	8_K	1.496	0.69
43_H	64_S	1.490	0.68
75_P	78_N	1.475	0.68
66_D	88_L	1.455	0.67
13_R	24_R	1.428	0.65
35_L	119_I	1.380	0.62
32_K	100_E	1.354	0.61
39_K	108_N	1.331	0.59
174_D	178_E	1.307	0.58
148_I	151_Y	1.297	0.57
72_W	84_L	1.296	0.57
112_P	136_V	1.249	0.54
14_R	38_R	1.248	0.54
105_I	110_A	1.241	0.54
62_A	92_R	1.239	0.54
60_A	93_A	1.226	0.53
81_A	92_R	1.221	0.53
88_L	92_R	1.205	0.52
70_Y	176_T	1.185	0.51
48_L	89_A	1.146	0.48
24_R	38_R	1.133	0.47
47_Q	62_A	1.121	0.47
52_G	57_E	1.116	0.46
123_A	130_V	1.110	0.46
25_L	28_L	1.099	0.45
28_L	100_E	1.083	0.44
59_V	97_G	1.082	0.44
11_M	120_Q	1.072	0.44
87_L	91_Q	1.070	0.43
150_E	153_E	1.059	0.43
103_L	132_H	1.039	0.42
66_D	92_R	1.039	0.42
81_A	85_T	1.035	0.41
120_Q	124_I	1.034	0.41
118_A	138_A	1.027	0.41
125_D	164_F	1.026	0.41
80_P	101_A	1.024	0.41
140_W	143_T	1.022	0.41
72_W	172_H	1.021	0.41
13_R	19_T	1.021	0.41
175_E	182_E	1.020	0.40
167_T	174_D	0.998	0.39
170_P	173_F	0.986	0.38
18_R	62_A	0.982	0.38
19_T	24_R	0.981	0.38
37_A	119_I	0.973	0.38
155_L	163_D	0.972	0.38
35_L	46_A	0.955	0.37
155_L	164_F	0.949	0.36
152_A	164_F	0.946	0.36
80_P	145_G	0.935	0.36
44_V	109_T	0.932	0.35
154_S	161_S	0.922	0.35
22_H	26_R	0.920	0.35
106_G	125_D	0.914	0.34
87_L	90_G	0.913	0.34
28_L	51_T	0.909	0.34
31_G	136_V	0.908	0.34
142_R	147_H	0.902	0.34
79_L	128_L	0.901	0.34
148_I	159_L	0.895	0.33
25_L	29_K	0.876	0.32
102_V	176_T	0.875	0.32
84_L	102_V	0.872	0.32
33_P	50_T	0.867	0.32
43_H	58_T	0.865	0.32
2_A	95_D	0.862	0.32
60_A	92_R	0.848	0.31
28_L	178_E	0.840	0.30
30_S	59_V	0.839	0.30
145_G	148_I	0.832	0.30
39_K	57_E	0.829	0.30
121_E	125_D	0.827	0.30
156_D	159_L	0.824	0.30
146_E	150_E	0.820	0.29
116_V	119_I	0.819	0.29
166_A	182_E	0.818	0.29
74_A	79_L	0.818	0.29
103_L	122_G	0.812	0.29
74_A	84_L	0.811	0.29
85_T	119_I	0.811	0.29
20_D	27_L	0.811	0.29
79_L	93_A	0.810	0.29
43_H	77_G	0.810	0.29
40_S	77_G	0.806	0.29
33_P	136_V	0.795	0.28
72_W	110_A	0.794	0.28
36_V	58_T	0.788	0.28
117_F	133_N	0.783	0.27
44_V	116_V	0.776	0.27
100_E	115_K	0.768	0.27
153_E	167_T	0.764	0.27
14_R	24_R	0.764	0.27
89_A	124_I	0.762	0.26
18_R	66_D	0.761	0.26
65_S	77_G	0.760	0.26
50_T	69_A	0.760	0.26
37_A	46_A	0.759	0.26
115_K	138_A	0.759	0.26
162_G	165_D	0.757	0.26
74_A	93_A	0.757	0.26
46_A	130_V	0.755	0.26
179_A	182_E	0.753	0.26
169_L	172_H	0.747	0.26
104_D	107_L	0.744	0.26
2_A	9_V	0.741	0.25
168_A	171_A	0.736	0.25
165_D	171_A	0.734	0.25
35_L	90_G	0.733	0.25
23_Q	37_A	0.733	0.25
162_G	166_A	0.731	0.25
3_T	20_D	0.725	0.25
113_G	132_H	0.723	0.25
34_R	104_D	0.723	0.25
110_A	126_A	0.716	0.24
62_A	152_A	0.713	0.24
51_T	78_N	0.711	0.24
27_L	102_V	0.709	0.24
93_A	97_G	0.706	0.24
70_Y	128_L	0.705	0.24
36_V	104_D	0.700	0.24
160_Y	166_A	0.699	0.24
129_D	161_S	0.695	0.23
14_R	19_T	0.694	0.23
62_A	67_L	0.693	0.23
144_R	174_D	0.691	0.23
24_R	56_D	0.690	0.23
20_D	24_R	0.690	0.23
38_R	56_D	0.689	0.23
21_Y	104_D	0.689	0.23
85_T	92_R	0.688	0.23
144_R	152_A	0.688	0.23
142_R	175_E	0.686	0.23
38_R	104_D	0.682	0.23
41_N	51_T	0.678	0.23
34_R	38_R	0.674	0.22
107_L	114_S	0.669	0.22
35_L	48_L	0.668	0.22
56_D	86_G	0.668	0.22
20_D	26_R	0.666	0.22
67_L	70_Y	0.663	0.22
50_T	59_V	0.660	0.22
22_H	149_A	0.659	0.22
60_A	101_A	0.659	0.22
154_S	168_A	0.651	0.21
102_V	147_H	0.650	0.21
156_D	163_D	0.646	0.21
68_D	112_P	0.646	0.21
39_K	44_V	0.640	0.21
62_A	88_L	0.637	0.21
141_S	157_E	0.635	0.21
51_T	81_A	0.630	0.21
37_A	81_A	0.630	0.21
7_Y	12_R	0.629	0.21
64_S	88_L	0.629	0.21
75_P	115_K	0.622	0.20
40_S	60_A	0.622	0.20
58_T	115_K	0.621	0.20
79_L	84_L	0.619	0.20
21_Y	24_R	0.619	0.20
170_P	177_R	0.614	0.20
52_G	102_V	0.613	0.20
97_G	147_H	0.612	0.20
165_D	182_E	0.611	0.20
159_L	174_D	0.610	0.20
54_D	146_E	0.610	0.20
27_L	75_P	0.610	0.20
89_A	119_I	0.609	0.20
4_G	8_K	0.608	0.20
97_G	142_R	0.606	0.20
70_Y	141_S	0.606	0.20
153_E	171_A	0.603	0.20
44_V	64_S	0.600	0.19
175_E	178_E	0.594	0.19
137_L	143_T	0.594	0.19
173_F	176_T	0.593	0.19
5_P	108_N	0.593	0.19
59_V	69_A	0.589	0.19
106_G	122_G	0.587	0.19
39_K	150_E	0.585	0.19
167_T	170_P	0.585	0.19
122_G	125_D	0.582	0.19
178_E	181_M	0.581	0.19
90_G	94_V	0.580	0.19
56_D	83_Y	0.578	0.19
106_G	121_E	0.576	0.19
72_W	120_Q	0.574	0.18
83_Y	86_G	0.574	0.18
59_V	129_D	0.573	0.18
21_Y	86_G	0.570	0.18
132_H	137_L	0.566	0.18
170_P	181_M	0.561	0.18
129_D	134_D	0.560	0.18
114_S	120_Q	0.558	0.18
19_T	78_N	0.557	0.18
144_R	154_S	0.557	0.18
34_R	117_F	0.554	0.18
58_T	151_Y	0.553	0.18
12_R	162_G	0.552	0.18
107_L	116_V	0.551	0.18
6_R	27_L	0.550	0.18
138_A	142_R	0.548	0.18
18_R	73_A	0.548	0.18
54_D	120_Q	0.544	0.17
48_L	114_S	0.544	0.17
44_V	87_L	0.543	0.17
96_A	114_S	0.543	0.17
25_L	138_A	0.542	0.17
17_V	20_D	0.540	0.17
3_T	31_G	0.538	0.17
137_L	152_A	0.537	0.17
42_K	95_D	0.534	0.17
106_G	131_P	0.533	0.17
72_W	93_A	0.532	0.17
108_N	116_V	0.531	0.17
11_M	148_I	0.530	0.17
38_R	67_L	0.526	0.17
61_S	96_A	0.525	0.17
75_P	92_R	0.524	0.17
155_L	162_G	0.522	0.17
111_T	132_H	0.517	0.16
5_P	80_P	0.516	0.16
28_L	40_S	0.516	0.16
11_M	103_L	0.513	0.16
14_R	36_V	0.513	0.16
81_A	88_L	0.513	0.16
65_S	68_D	0.508	0.16
87_L	177_R	0.508	0.16
124_I	176_T	0.508	0.16
49_V	175_E	0.504	0.16
57_E	142_R	0.503	0.16
99_E	112_P	0.502	0.16
38_R	127_G	0.502	0.16
60_A	98_V	0.501	0.16
9_V	87_L	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zf7u	1	1	100	0.215	Contact Map
4ujqG	1	1	100	0.217	Contact Map
1vq8N	1	0.9945	100	0.221	Contact Map
3j61D	1	0.9836	100	0.225	Contact Map
4a17M	1	1	100	0.229	Contact Map
3j39D	1	1	100	0.231	Contact Map
3j21O	1	1	100	0.234	Contact Map
4w20D	1	1	100	0.237	Contact Map
1vx7R	1	1	100	0.239	Contact Map
1ovyA	1	0.5137	100	0.646	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.