RS10 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS10 - 30S ribosomal protein S10

UniProt:	P48854	Sequences: MQQARVRLAGVDPDDLDNICGEVQEIADKTGVKVSGPVPLPTKTLEVPSRKSPDGEGTATWEHWEMRVHKRLIDIDADERALRQLMRIQVPNDVNIEIVLED	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	102 (98)
Sequences:	1018 (445)
Seq/√Len:	44.9

ECOLI - RS10
BACSU - RS10
HALSA - RS10
SULSO - RS10

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_R	74_D	5.560	1.00
48_P	63_H	3.985	1.00
51_K	60_T	3.961	1.00
45_L	68_V	3.921	1.00
30_T	81_A	3.885	1.00
10_G	16_L	2.685	1.00
48_P	61_W	2.652	1.00
50_R	53_P	2.292	1.00
52_S	56_E	2.172	1.00
21_G	25_E	2.137	1.00
16_L	20_C	1.705	0.98
50_R	54_D	1.634	0.97
50_R	59_A	1.590	0.97
52_S	55_G	1.547	0.96
13_P	17_D	1.482	0.95
20_C	35_S	1.471	0.95
33_K	76_D	1.470	0.95
91_P	96_I	1.431	0.94
40_L	72_L	1.417	0.94
38_V	87_R	1.368	0.92
50_R	60_T	1.313	0.91
26_I	29_K	1.290	0.90
6_V	75_I	1.284	0.90
52_S	58_T	1.282	0.90
44_T	67_R	1.270	0.89
42_T	69_H	1.264	0.89
25_E	29_K	1.201	0.86
35_S	66_M	1.191	0.86
60_T	64_W	1.179	0.85
43_K	70_K	1.177	0.85
52_S	59_A	1.173	0.85
45_L	66_M	1.157	0.84
55_G	59_A	1.157	0.84
50_R	68_V	1.142	0.83
50_R	55_G	1.134	0.83
22_E	89_Q	1.130	0.83
53_P	56_E	1.096	0.81
6_V	67_R	1.084	0.80
38_V	72_L	1.051	0.78
3_Q	35_S	1.028	0.76
7_R	43_K	1.023	0.76
70_K	73_I	1.019	0.76
10_G	89_Q	1.016	0.75
27_A	73_I	0.995	0.74
73_I	83_R	0.963	0.71
38_V	70_K	0.956	0.71
45_L	48_P	0.944	0.70
3_Q	16_L	0.942	0.70
8_L	94_V	0.935	0.69
95_N	100_L	0.935	0.69
46_E	63_H	0.912	0.67
24_Q	28_D	0.906	0.67
45_L	49_S	0.896	0.66
16_L	19_I	0.890	0.65
51_K	64_W	0.888	0.65
35_S	73_I	0.853	0.62
85_L	99_V	0.848	0.62
45_L	55_G	0.841	0.61
21_G	78_D	0.818	0.59
75_I	81_A	0.816	0.59
26_I	86_M	0.816	0.59
79_E	86_M	0.816	0.59
52_S	60_T	0.813	0.58
47_V	66_M	0.801	0.57
8_L	16_L	0.795	0.57
29_K	69_H	0.795	0.57
23_V	99_V	0.793	0.56
13_P	69_H	0.791	0.56
74_D	88_I	0.786	0.56
50_R	61_W	0.785	0.56
37_P	71_R	0.782	0.55
43_K	56_E	0.781	0.55
68_V	72_L	0.774	0.55
84_Q	87_R	0.767	0.54
8_L	100_L	0.763	0.54
23_V	26_I	0.762	0.53
16_L	80_R	0.746	0.52
7_R	14_D	0.732	0.51
15_D	33_K	0.729	0.50
51_K	54_D	0.729	0.50
32_V	81_A	0.729	0.50
47_V	68_V	0.728	0.50
53_P	86_M	0.726	0.50
55_G	61_W	0.726	0.50
39_P	71_R	0.725	0.50
10_G	43_K	0.724	0.50
22_E	87_R	0.721	0.49
18_N	22_E	0.713	0.49
35_S	91_P	0.709	0.48
32_V	78_D	0.703	0.48
45_L	70_K	0.700	0.47
56_E	59_A	0.699	0.47
16_L	69_H	0.687	0.46
21_G	94_V	0.686	0.46
22_E	28_D	0.684	0.46
30_T	85_L	0.682	0.46
52_S	65_E	0.679	0.45
80_R	96_I	0.677	0.45
68_V	78_D	0.677	0.45
14_D	17_D	0.676	0.45
15_D	93_D	0.674	0.45
10_G	66_M	0.672	0.45
7_R	70_K	0.669	0.44
62_E	79_E	0.654	0.43
26_I	78_D	0.651	0.43
86_M	97_E	0.651	0.43
24_Q	66_M	0.634	0.41
17_D	39_P	0.628	0.41
86_M	96_I	0.625	0.40
3_Q	72_L	0.624	0.40
56_E	70_K	0.622	0.40
54_D	61_W	0.607	0.39
7_R	40_L	0.598	0.38
18_N	95_N	0.596	0.38
82_L	86_M	0.596	0.38
18_N	82_L	0.593	0.37
12_D	38_V	0.588	0.37
32_V	98_I	0.587	0.37
15_D	19_I	0.585	0.37
49_S	55_G	0.578	0.36
47_V	55_G	0.577	0.36
54_D	58_T	0.576	0.36
19_I	90_V	0.571	0.35
24_Q	34_V	0.571	0.35
16_L	66_M	0.571	0.35
12_D	15_D	0.569	0.35
2_Q	100_L	0.567	0.35
9_A	97_E	0.565	0.35
26_I	88_I	0.562	0.35
25_E	100_L	0.559	0.34
56_E	61_W	0.559	0.34
18_N	28_D	0.544	0.33
34_V	48_P	0.540	0.33
42_T	50_R	0.537	0.32
26_I	64_W	0.536	0.32
14_D	29_K	0.535	0.32
43_K	92_N	0.528	0.32
23_V	31_G	0.522	0.31
69_H	96_I	0.519	0.31
48_P	54_D	0.519	0.31
30_T	80_R	0.519	0.31
66_M	70_K	0.515	0.31
25_E	59_A	0.515	0.31
15_D	83_R	0.514	0.30
65_E	76_D	0.506	0.30
27_A	85_L	0.503	0.30
88_I	99_V	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j20L	1	1	100	0.175	Contact Map
3j7aN	1	0.951	100	0.183	Contact Map
3j60U	1	1	100	0.188	Contact Map
4ujpV	1	1	100	0.19	Contact Map
4bpeJ	1	1	100	0.196	Contact Map
3zeyQ	1	1	100	0.201	Contact Map
4w23U	1	1	100	0.21	Contact Map
3bbnJ	1	0.9608	100	0.223	Contact Map
4rb5J	1	0.9412	100	0.225	Contact Map
3w1yC	1	0.8725	100	0.24	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.