GVPF2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GVPF2 - Protein GvpF 2

UniProt:	P33959	Sequences: MSESHLYTYGIIDDNESLALNVDGVAGATRAYTVSYRSLSAVVSDIETTDPERTDAAVEAHNTVLQAVLEHDATRAVVPMSFGMAFKNARTLKGVLRGARRALRSTLTEIAGTVELGVKVLAPGDDTAVDTAAVRSDVTARLSALSVGETENDCFTDRLIINKSYLVEHDTRDAFDAAIDEIDAAHDDLTVRYTGPWPPYNFVDIHIGAEQAQQGGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	217 (197)
Sequences:	952 (753)
Seq/√Len:	53.6

HALSA - GVPF2 GVPF1 GVPL2 GVPL1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
171_T	174_A	5.443	1.00
42_V	68_V	4.899	1.00
165_Y	175_F	4.128	1.00
113_T	147_V	3.481	1.00
113_T	168_E	3.366	1.00
6_L	89_A	2.864	1.00
10_G	65_L	2.725	1.00
99_A	102_A	2.706	1.00
114_V	169_H	2.504	1.00
119_K	162_N	2.463	1.00
38_S	100_R	2.399	1.00
41_A	92_L	2.325	1.00
32_Y	45_D	2.315	1.00
90_R	93_K	2.299	1.00
109_E	148_G	2.299	1.00
32_Y	89_A	2.243	1.00
139_T	165_Y	2.182	1.00
117_G	197_W	2.159	1.00
13_D	108_T	2.092	1.00
5_H	48_T	2.044	1.00
9_Y	44_S	1.895	0.99
159_L	162_N	1.869	0.99
176_D	193_Y	1.835	0.99
7_Y	61_H	1.814	0.99
194_T	197_W	1.800	0.99
120_V	191_V	1.786	0.99
37_R	100_R	1.781	0.99
78_V	106_T	1.773	0.99
147_V	168_E	1.760	0.99
13_D	111_A	1.723	0.99
105_S	109_E	1.694	0.99
152_N	201_N	1.676	0.99
26_A	44_S	1.667	0.99
33_T	40_S	1.652	0.99
36_Y	100_R	1.637	0.98
168_E	171_T	1.618	0.98
29_T	44_S	1.595	0.98
55_D	58_V	1.533	0.98
6_L	45_D	1.527	0.98
118_V	191_V	1.520	0.97
114_V	172_R	1.509	0.97
117_G	201_N	1.509	0.97
46_I	51_P	1.466	0.97
45_D	89_A	1.450	0.97
25_V	60_A	1.398	0.96
100_R	104_R	1.382	0.96
139_T	194_T	1.381	0.96
92_L	112_G	1.371	0.95
139_T	143_S	1.362	0.95
9_Y	81_S	1.360	0.95
119_K	155_F	1.347	0.95
62_N	66_Q	1.344	0.95
117_G	162_N	1.337	0.95
8_T	80_M	1.327	0.94
10_G	68_V	1.320	0.94
55_D	59_E	1.309	0.94
76_A	110_I	1.302	0.94
139_T	149_E	1.265	0.93
146_S	179_I	1.264	0.93
173_D	177_A	1.246	0.92
137_D	185_A	1.239	0.92
10_G	42_V	1.236	0.92
58_V	82_F	1.230	0.92
12_I	42_V	1.221	0.92
152_N	164_S	1.220	0.91
57_A	82_F	1.218	0.91
112_G	170_D	1.206	0.91
116_L	172_R	1.205	0.91
82_F	198_P	1.201	0.91
106_T	109_E	1.195	0.91
7_Y	198_P	1.149	0.89
31_A	68_V	1.138	0.88
31_A	64_V	1.137	0.88
34_V	107_L	1.124	0.88
117_G	194_T	1.105	0.87
14_D	40_S	1.105	0.87
115_E	197_W	1.097	0.86
120_V	161_I	1.087	0.86
58_V	62_N	1.082	0.86
78_V	82_F	1.076	0.85
142_L	175_F	1.064	0.85
121_L	159_L	1.062	0.85
128_A	132_A	1.058	0.84
141_R	185_A	1.055	0.84
34_V	93_K	1.054	0.84
89_A	93_K	1.044	0.84
62_N	201_N	1.043	0.83
136_S	141_R	1.040	0.83
139_T	151_E	1.038	0.83
122_A	160_I	1.034	0.83
34_V	43_V	1.032	0.83
118_V	189_L	1.031	0.83
55_D	62_N	1.028	0.83
180_D	184_A	1.019	0.82
34_V	96_L	1.018	0.82
97_R	177_A	1.015	0.82
44_S	57_A	1.013	0.82
66_Q	198_P	1.013	0.82
11_I	39_L	1.004	0.81
180_D	183_D	0.998	0.81
14_D	38_S	0.990	0.80
41_A	112_G	0.989	0.80
80_M	84_M	0.988	0.80
129_V	184_A	0.983	0.80
92_L	95_V	0.982	0.80
91_T	94_G	0.977	0.79
84_M	156_T	0.976	0.79
188_D	197_W	0.976	0.79
172_R	176_D	0.968	0.79
141_R	182_I	0.964	0.78
155_F	159_L	0.957	0.78
162_N	201_N	0.944	0.77
41_A	107_L	0.924	0.75
102_A	140_A	0.919	0.75
60_A	119_K	0.917	0.75
61_H	119_K	0.898	0.73
6_L	199_P	0.898	0.73
136_S	140_A	0.894	0.73
139_T	144_A	0.888	0.72
123_P	190_T	0.879	0.72
137_D	140_A	0.876	0.71
8_T	21_N	0.868	0.71
86_F	119_K	0.868	0.71
38_S	171_T	0.861	0.70
111_A	168_E	0.856	0.70
7_Y	200_Y	0.854	0.69
14_D	35_S	0.853	0.69
26_A	107_L	0.853	0.69
12_I	40_S	0.842	0.68
11_I	103_L	0.841	0.68
34_V	111_A	0.841	0.68
141_R	181_E	0.839	0.68
138_V	180_D	0.836	0.68
152_N	155_F	0.833	0.67
112_G	169_H	0.817	0.66
66_Q	69_L	0.813	0.66
9_Y	24_G	0.812	0.65
76_A	108_T	0.811	0.65
51_P	83_G	0.801	0.64
105_S	125_D	0.800	0.64
11_I	31_A	0.798	0.64
116_L	167_V	0.796	0.64
6_L	77_V	0.795	0.64
179_I	193_Y	0.794	0.64
35_S	38_S	0.793	0.64
167_V	175_F	0.793	0.64
24_G	31_A	0.792	0.64
117_G	160_I	0.791	0.63
86_F	192_R	0.789	0.63
96_L	107_L	0.780	0.62
82_F	131_T	0.780	0.62
121_L	192_R	0.778	0.62
17_S	70_E	0.775	0.62
159_L	198_P	0.772	0.62
186_H	198_P	0.768	0.61
145_L	182_I	0.765	0.61
55_D	82_F	0.764	0.61
10_G	31_A	0.762	0.61
129_V	133_A	0.753	0.60
151_E	163_K	0.751	0.59
33_T	42_V	0.748	0.59
8_T	92_L	0.746	0.59
140_A	143_S	0.745	0.59
133_A	170_D	0.744	0.59
116_L	193_Y	0.744	0.59
58_V	192_R	0.743	0.59
86_F	95_V	0.735	0.58
136_S	139_T	0.724	0.57
81_S	85_A	0.722	0.56
181_E	185_A	0.720	0.56
5_H	50_D	0.717	0.56
9_Y	25_V	0.715	0.56
146_S	165_Y	0.711	0.55
41_A	96_L	0.705	0.55
118_V	168_E	0.703	0.54
76_A	111_A	0.697	0.54
81_S	88_N	0.697	0.54
81_S	84_M	0.696	0.54
43_V	92_L	0.696	0.54
174_A	177_A	0.695	0.54
36_Y	97_R	0.695	0.54
52_E	58_V	0.693	0.53
78_V	81_S	0.693	0.53
68_V	161_I	0.693	0.53
100_R	174_A	0.692	0.53
60_A	154_C	0.691	0.53
75_R	198_P	0.683	0.52
51_P	54_T	0.683	0.52
27_G	30_R	0.679	0.52
175_F	179_I	0.674	0.51
136_S	154_C	0.672	0.51
69_L	201_N	0.670	0.51
58_V	197_W	0.669	0.51
22_V	68_V	0.668	0.51
164_S	201_N	0.667	0.51
75_R	164_S	0.660	0.50
15_N	19_A	0.659	0.50
15_N	35_S	0.658	0.50
65_L	83_G	0.656	0.49
10_G	77_V	0.656	0.49
111_A	174_A	0.653	0.49
118_V	165_Y	0.652	0.49
68_V	75_R	0.650	0.49
11_I	87_K	0.644	0.48
57_A	83_G	0.642	0.48
165_Y	197_W	0.642	0.48
80_M	190_T	0.638	0.48
149_E	165_Y	0.637	0.47
139_T	163_K	0.635	0.47
139_T	161_I	0.629	0.47
65_L	197_W	0.624	0.46
106_T	110_I	0.623	0.46
37_R	110_I	0.623	0.46
21_N	177_A	0.622	0.46
27_G	56_A	0.618	0.45
34_V	65_L	0.614	0.45
118_V	180_D	0.612	0.45
31_A	188_D	0.612	0.45
122_A	189_L	0.612	0.45
51_P	116_L	0.611	0.45
8_T	41_A	0.607	0.44
125_D	132_A	0.607	0.44
65_L	84_M	0.605	0.44
44_S	83_G	0.603	0.44
42_V	161_I	0.603	0.44
10_G	58_V	0.600	0.44
87_K	91_T	0.593	0.43
63_T	137_D	0.592	0.43
79_P	202_F	0.590	0.42
64_V	199_P	0.588	0.42
21_N	134_V	0.586	0.42
169_H	189_L	0.586	0.42
26_A	57_A	0.584	0.42
118_V	146_S	0.580	0.41
126_D	200_Y	0.580	0.41
38_S	104_R	0.578	0.41
117_G	165_Y	0.573	0.41
80_M	88_N	0.573	0.41
53_R	201_N	0.571	0.41
39_L	107_L	0.571	0.41
142_L	150_T	0.570	0.40
57_A	117_G	0.570	0.40
117_G	158_R	0.570	0.40
23_D	27_G	0.570	0.40
54_T	162_N	0.568	0.40
115_E	198_P	0.567	0.40
31_A	44_S	0.567	0.40
39_L	135_R	0.564	0.40
38_S	41_A	0.564	0.40
9_Y	78_V	0.564	0.40
142_L	189_L	0.564	0.40
101_R	178_A	0.562	0.40
111_A	169_H	0.560	0.39
38_S	120_V	0.560	0.39
6_L	92_L	0.559	0.39
76_A	169_H	0.558	0.39
115_E	201_N	0.554	0.39
79_P	166_L	0.554	0.39
99_A	123_P	0.552	0.39
68_V	105_S	0.551	0.38
154_C	189_L	0.550	0.38
116_L	176_D	0.550	0.38
173_D	178_A	0.549	0.38
21_N	50_D	0.548	0.38
48_T	102_A	0.546	0.38
46_I	165_Y	0.546	0.38
6_L	32_Y	0.541	0.37
125_D	129_V	0.541	0.37
62_N	69_L	0.539	0.37
118_V	160_I	0.538	0.37
88_N	187_D	0.538	0.37
20_L	205_I	0.538	0.37
178_A	181_E	0.537	0.37
63_T	123_P	0.534	0.37
103_L	198_P	0.529	0.36
10_G	69_L	0.528	0.36
22_V	58_V	0.528	0.36
119_K	159_L	0.526	0.36
120_V	197_W	0.524	0.36
123_P	173_D	0.522	0.36
96_L	114_V	0.521	0.36
127_T	131_T	0.520	0.35
186_H	189_L	0.519	0.35
103_L	108_T	0.519	0.35
57_A	201_N	0.517	0.35
5_H	53_R	0.517	0.35
120_V	189_L	0.516	0.35
137_D	141_R	0.512	0.35
41_A	80_M	0.511	0.35
151_E	154_C	0.508	0.34
69_L	198_P	0.505	0.34
26_A	70_E	0.505	0.34
146_S	163_K	0.504	0.34
62_N	152_N	0.503	0.34
125_D	177_A	0.502	0.34
9_Y	31_A	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qsgA	1	0.9263	100	0.125	Contact Map
2hn1A	2	0.7281	9.7	0.957	Contact Map
3v4gA	5	0.4147	9	0.957	Contact Map
3u0kA	1	0.3502	7.7	0.959	Contact Map
3lapA	6	0.4286	6.9	0.96	Contact Map
3vv5A	1	0.2028	6.7	0.96	Contact Map
2bbhA	2	0.6221	5.3	0.962	Contact Map
2cveA	1	0.6267	5.2	0.962	Contact Map
3fkuX	1	0.1382	4.9	0.962	Contact Map
1vi7A	1	0.6544	4.8	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.