Y1336 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y1336 - Putative esterase VNG_1336C

UniProt:	P20378	Sequences: MTGFDADDAAALIQSYVDDHGLLSFLGVSVEDASDGEMRLRIPYHEKLTNHGPGEGDVHGGIAATLIDTAGGLAVRSALPKPVAANVATIDLNVSYLRPARGDLIADASVVRVGSTVGVAEISVVTPADTADAEPTEVAVGRGSFRVFRDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (122)
Sequences:	5068 (3407)
Seq/√Len:	308.5

ECOLI - YIGI PAAI MENI ENTH
BACSU - COMA2
HALSA - Y1336
SULSO - Q97UX9 Y1253 Y2140 Q97VK2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_R	103_D	3.469	1.00
31_E	41_R	3.162	1.00
90_I	117_V	2.664	1.00
39_R	107_D	2.559	1.00
107_D	125_V	2.338	1.00
32_D	37_E	2.245	1.00
29_S	41_R	2.222	1.00
32_D	39_R	2.182	1.00
40_L	70_A	2.100	1.00
126_T	134_E	2.086	1.00
42_I	62_I	2.041	1.00
34_S	37_E	2.010	1.00
64_A	92_L	1.997	1.00
123_S	137_E	1.997	1.00
71_G	122_I	1.970	1.00
37_E	109_S	1.890	1.00
75_V	118_G	1.827	1.00
41_R	105_I	1.758	1.00
70_A	106_A	1.756	1.00
43_P	103_D	1.690	1.00
126_T	136_T	1.689	1.00
37_E	107_D	1.688	1.00
121_E	140_V	1.678	1.00
98_R	136_T	1.672	1.00
39_R	105_I	1.661	1.00
109_S	123_S	1.651	1.00
109_S	121_E	1.645	1.00
67_I	122_I	1.610	1.00
67_I	141_G	1.579	1.00
31_E	39_R	1.574	1.00
91_D	95_S	1.542	1.00
111_V	121_E	1.514	1.00
64_A	96_Y	1.432	1.00
25_F	47_K	1.400	1.00
111_V	140_V	1.379	1.00
100_A	138_V	1.358	1.00
64_A	94_V	1.355	1.00
22_L	62_I	1.331	1.00
110_V	113_V	1.331	1.00
71_G	143_G	1.327	1.00
78_A	113_V	1.303	1.00
67_I	124_V	1.296	1.00
14_Q	18_D	1.286	1.00
36_G	77_S	1.281	1.00
66_L	106_A	1.261	1.00
22_L	65_T	1.238	1.00
125_V	135_P	1.235	1.00
106_A	122_I	1.214	1.00
100_A	104_L	1.195	1.00
63_A	139_A	1.192	1.00
44_Y	58_V	1.179	1.00
45_H	48_L	1.176	1.00
58_V	104_L	1.154	1.00
75_V	145_F	1.132	1.00
123_S	140_V	1.124	1.00
75_V	120_A	1.124	1.00
74_A	110_V	1.100	1.00
46_E	49_T	1.096	1.00
49_T	101_R	1.073	1.00
29_S	103_D	1.071	1.00
94_V	139_A	1.065	1.00
103_D	127_P	1.042	1.00
118_G	147_V	1.037	1.00
121_E	142_R	0.978	1.00
97_L	140_V	0.956	1.00
107_D	123_S	0.947	1.00
68_D	89_T	0.943	1.00
112_R	117_V	0.938	1.00
42_I	66_L	0.926	1.00
119_V	144_S	0.924	1.00
29_S	43_P	0.923	1.00
15_S	18_D	0.922	1.00
63_A	96_Y	0.920	1.00
63_A	124_V	0.911	1.00
48_L	62_I	0.886	1.00
76_R	86_N	0.884	1.00
104_L	138_V	0.880	1.00
125_V	137_E	0.878	1.00
78_A	110_V	0.872	1.00
60_G	96_Y	0.869	1.00
57_D	88_A	0.867	1.00
71_G	120_A	0.852	1.00
80_P	85_A	0.842	1.00
107_D	135_P	0.826	1.00
95_S	119_V	0.824	1.00
97_L	112_R	0.823	1.00
71_G	145_F	0.800	1.00
116_T	146_R	0.799	1.00
28_V	40_L	0.797	1.00
93_N	142_R	0.788	1.00
110_V	120_A	0.786	1.00
61_G	65_T	0.784	1.00
106_A	124_V	0.780	0.99
112_R	119_V	0.779	0.99
51_H	72_G	0.765	0.99
68_D	72_G	0.758	0.99
105_I	127_P	0.757	0.99
31_E	103_D	0.754	0.99
44_Y	48_L	0.751	0.99
35_D	78_A	0.747	0.99
63_A	100_A	0.746	0.99
74_A	108_A	0.744	0.99
97_L	137_E	0.741	0.99
104_L	124_V	0.741	0.99
44_Y	49_T	0.741	0.99
30_V	40_L	0.734	0.99
43_P	48_L	0.733	0.99
127_P	134_E	0.728	0.99
23_L	69_T	0.722	0.99
95_S	144_S	0.722	0.99
28_V	42_I	0.721	0.99
59_H	69_T	0.719	0.99
92_L	96_Y	0.715	0.99
71_G	141_G	0.714	0.99
105_I	135_P	0.712	0.99
117_V	146_R	0.710	0.99
67_I	94_V	0.696	0.99
46_E	101_R	0.683	0.99
40_L	108_A	0.680	0.99
98_R	112_R	0.667	0.98
95_S	142_R	0.666	0.98
92_L	141_G	0.662	0.98
91_D	142_R	0.662	0.98
108_A	122_I	0.662	0.98
105_I	125_V	0.654	0.98
36_G	74_A	0.652	0.98
76_R	87_V	0.642	0.98
27_G	47_K	0.641	0.98
18_D	24_S	0.639	0.98
91_D	144_S	0.636	0.98
90_I	146_R	0.635	0.98
24_S	47_K	0.626	0.98
113_V	118_G	0.623	0.98
72_G	145_F	0.620	0.97
89_T	145_F	0.607	0.97
79_L	147_V	0.605	0.97
52_G	57_D	0.600	0.97
95_S	140_V	0.600	0.97
70_A	108_A	0.598	0.97
38_M	74_A	0.591	0.97
36_G	78_A	0.590	0.97
119_V	140_V	0.583	0.96
19_D	24_S	0.581	0.96
97_L	119_V	0.578	0.96
63_A	138_V	0.578	0.96
85_A	147_V	0.577	0.96
23_L	73_L	0.574	0.96
41_R	127_P	0.574	0.96
137_E	140_V	0.574	0.96
89_T	92_L	0.572	0.96
89_T	143_G	0.571	0.96
122_I	143_G	0.569	0.96
105_I	126_T	0.568	0.96
75_V	87_V	0.566	0.96
33_A	77_S	0.566	0.96
49_T	57_D	0.560	0.95
126_T	138_V	0.554	0.95
52_G	88_A	0.551	0.95
21_G	24_S	0.548	0.95
50_N	60_G	0.547	0.95
15_S	19_D	0.544	0.95
74_A	120_A	0.539	0.94
48_L	58_V	0.536	0.94
126_T	135_P	0.536	0.94
23_L	28_V	0.535	0.94
31_E	105_I	0.532	0.94
98_R	126_T	0.530	0.94
75_V	113_V	0.528	0.94
57_D	99_P	0.522	0.93
79_L	85_A	0.521	0.93
36_G	110_V	0.518	0.93
44_Y	104_L	0.517	0.93
25_F	48_L	0.514	0.93
30_V	73_L	0.514	0.93
98_R	146_R	0.513	0.93
58_V	100_A	0.509	0.93
20_H	51_H	0.508	0.92
88_A	146_R	0.506	0.92
111_V	123_S	0.506	0.92
93_N	144_S	0.505	0.92
111_V	137_E	0.504	0.92
31_E	40_L	0.502	0.92
122_I	141_G	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3e8pA	3	0.9139	99.9	0.334	Contact Map
4rmmA	2	0.8874	99.9	0.335	Contact Map
3f1tA	2	0.8742	99.9	0.337	Contact Map
3lmbA	2	0.9669	99.9	0.343	Contact Map
3e1eA	3	0.9073	99.9	0.344	Contact Map
1sh8A	2	0.894	99.9	0.346	Contact Map
1t82A	2	0.9139	99.9	0.348	Contact Map
3gekA	3	0.8013	99.9	0.354	Contact Map
3hduA	4	0.9073	99.9	0.355	Contact Map
3nwzA	3	0.9272	99.9	0.36	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0087 seconds.