FLAB3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLAB3 - Flagellin B3

UniProt:	P13078	Sequences: MFEFITDEDERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGYLQSKGSATGEEASAQVSNRINIVSAYGNVNSEKVDYVNLTVRQAAGADNINLTKSTIQWIGPDKATTLTYSSNSPSSLGENFTTESIKGNNADVLVEQSDRIKVIMYASGVSSTLGSGEEVQLTVTTQYGSKTTYWAHVPESLKDKNAVKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	193 (180)
Sequences:	307 (227)
Seq/√Len:	16.9

HALSA - FLAB3 FLAB1 FLAA2 FLAA1 FLAB2 Q9HQF9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_A	57_Q	4.571	1.00
181_V	185_L	4.319	1.00
70_N	77_D	3.966	1.00
42_Y	54_A	3.267	0.99
148_M	163_V	2.704	0.97
72_N	77_D	2.584	0.96
11_R	34_G	2.395	0.94
163_V	179_A	2.217	0.92
46_K	59_S	2.195	0.91
21_V	98_T	2.072	0.88
12_G	38_N	2.071	0.88
116_S	119_S	2.023	0.87
131_G	142_D	1.982	0.86
11_R	14_V	1.967	0.86
16_I	22_F	1.965	0.86
12_G	28_V	1.936	0.85
61_R	86_A	1.933	0.85
12_G	21_V	1.885	0.83
165_L	177_Y	1.863	0.82
14_V	68_Y	1.848	0.82
14_V	21_V	1.838	0.81
149_Y	152_G	1.796	0.80
18_T	32_A	1.794	0.80
79_V	148_M	1.759	0.78
25_M	87_A	1.710	0.76
34_G	160_G	1.705	0.76
25_M	36_L	1.675	0.75
57_Q	63_N	1.648	0.73
34_G	40_A	1.609	0.72
14_V	48_S	1.605	0.71
86_A	169_T	1.599	0.71
113_S	122_E	1.554	0.69
15_G	19_L	1.510	0.67
36_L	50_T	1.505	0.66
19_L	30_A	1.500	0.66
160_G	170_Q	1.496	0.66
79_V	104_P	1.491	0.66
75_K	187_D	1.482	0.65
101_W	157_L	1.436	0.63
22_F	28_V	1.433	0.62
36_L	40_A	1.425	0.62
110_L	148_M	1.417	0.62
139_E	160_G	1.394	0.60
62_I	96_K	1.355	0.58
112_Y	136_V	1.346	0.57
22_F	26_V	1.324	0.56
40_A	82_T	1.307	0.55
169_T	181_V	1.306	0.55
64_I	110_L	1.306	0.55
16_I	24_A	1.299	0.55
83_V	114_S	1.297	0.55
143_R	181_V	1.290	0.54
20_I	24_A	1.279	0.53
108_T	153_V	1.272	0.53
20_I	23_I	1.267	0.53
31_I	46_K	1.263	0.53
73_S	121_G	1.257	0.52
55_S	59_S	1.256	0.52
102_I	163_V	1.252	0.52
64_I	177_Y	1.246	0.52
52_E	56_A	1.241	0.51
61_R	175_T	1.238	0.51
79_V	101_W	1.231	0.51
57_Q	169_T	1.204	0.49
12_G	42_Y	1.199	0.49
12_G	130_K	1.198	0.49
31_I	40_A	1.197	0.49
49_A	178_W	1.196	0.49
38_N	42_Y	1.183	0.48
99_I	144_I	1.183	0.48
85_Q	89_A	1.180	0.48
59_S	175_T	1.179	0.48
113_S	149_Y	1.167	0.47
42_Y	57_Q	1.158	0.46
26_V	41_G	1.154	0.46
27_L	41_G	1.144	0.45
14_V	34_G	1.141	0.45
76_V	129_I	1.134	0.45
46_K	55_S	1.131	0.45
12_G	22_F	1.122	0.44
81_L	148_M	1.120	0.44
120_L	151_S	1.117	0.44
85_Q	165_L	1.108	0.43
54_A	63_N	1.084	0.42
167_V	177_Y	1.079	0.42
42_Y	52_E	1.076	0.41
21_V	36_L	1.074	0.41
28_V	53_E	1.056	0.40
92_I	168_T	1.041	0.39
115_N	120_L	1.036	0.39
15_G	22_F	1.033	0.39
161_E	185_L	1.024	0.39
40_A	49_A	1.015	0.38
9_D	52_E	1.003	0.37
65_V	143_R	0.991	0.37
177_Y	180_H	0.979	0.36
12_G	53_E	0.977	0.36
101_W	163_V	0.959	0.35
11_R	52_E	0.949	0.34
164_Q	168_T	0.948	0.34
26_V	39_T	0.946	0.34
118_S	151_S	0.946	0.34
49_A	63_N	0.942	0.34
169_T	185_L	0.934	0.34
125_T	147_I	0.933	0.34
114_S	155_S	0.932	0.33
21_V	42_Y	0.931	0.33
18_T	26_V	0.924	0.33
35_V	40_A	0.916	0.33
95_T	188_K	0.910	0.32
15_G	18_T	0.907	0.32
141_S	146_V	0.904	0.32
73_S	188_K	0.888	0.31
45_S	176_T	0.883	0.31
18_T	30_A	0.880	0.31
12_G	26_V	0.877	0.31
18_T	38_N	0.877	0.31
77_D	114_S	0.874	0.30
14_V	18_T	0.872	0.30
60_N	139_E	0.871	0.30
64_I	151_S	0.871	0.30
41_G	50_T	0.863	0.30
82_T	85_Q	0.860	0.30
34_G	48_S	0.852	0.29
42_Y	64_I	0.846	0.29
79_V	116_S	0.844	0.29
26_V	53_E	0.843	0.29
103_G	150_A	0.841	0.29
106_K	167_V	0.833	0.28
9_D	49_A	0.826	0.28
41_G	173_S	0.824	0.28
61_R	169_T	0.824	0.28
171_Y	174_K	0.822	0.28
126_T	139_E	0.821	0.28
113_S	156_T	0.814	0.28
133_N	142_D	0.810	0.27
71_V	79_V	0.807	0.27
55_S	61_R	0.806	0.27
40_A	185_L	0.803	0.27
127_E	147_I	0.802	0.27
165_L	179_A	0.801	0.27
26_V	55_S	0.800	0.27
42_Y	185_L	0.798	0.27
14_V	164_Q	0.795	0.27
42_Y	63_N	0.794	0.27
161_E	181_V	0.793	0.27
8_E	89_A	0.787	0.26
46_K	64_I	0.780	0.26
48_S	57_Q	0.779	0.26
55_S	169_T	0.779	0.26
49_A	55_S	0.775	0.26
116_S	121_G	0.774	0.26
110_L	166_T	0.772	0.26
84_R	180_H	0.770	0.25
26_V	38_N	0.770	0.25
56_A	97_S	0.768	0.25
45_S	60_N	0.759	0.25
24_A	33_A	0.755	0.25
46_K	50_T	0.749	0.25
19_L	22_F	0.742	0.24
105_D	158_G	0.739	0.24
120_L	149_Y	0.734	0.24
102_I	136_V	0.733	0.24
14_V	145_K	0.730	0.24
16_I	21_V	0.723	0.23
128_S	133_N	0.722	0.23
31_I	185_L	0.722	0.23
112_Y	124_F	0.718	0.23
25_M	32_A	0.718	0.23
120_L	148_M	0.717	0.23
34_G	46_K	0.716	0.23
71_V	77_D	0.714	0.23
122_E	187_D	0.714	0.23
98_T	163_V	0.707	0.23
57_Q	68_Y	0.704	0.23
21_V	54_A	0.703	0.23
20_I	88_G	0.702	0.23
14_V	66_S	0.702	0.23
83_V	168_T	0.701	0.22
104_P	136_V	0.701	0.22
76_V	134_A	0.701	0.22
45_S	90_D	0.696	0.22
39_T	43_L	0.691	0.22
132_N	160_G	0.687	0.22
71_V	155_S	0.683	0.22
108_T	113_S	0.682	0.22
81_L	101_W	0.680	0.22
93_N	170_Q	0.678	0.22
73_S	77_D	0.671	0.21
141_S	169_T	0.666	0.21
24_A	35_V	0.665	0.21
120_L	123_N	0.661	0.21
40_A	51_G	0.658	0.21
42_Y	46_K	0.657	0.21
79_V	156_T	0.656	0.21
122_E	167_V	0.655	0.21
86_A	165_L	0.655	0.21
123_N	152_G	0.652	0.21
11_R	38_N	0.650	0.20
126_T	130_K	0.648	0.20
110_L	168_T	0.648	0.20
62_I	168_T	0.639	0.20
41_G	55_S	0.638	0.20
42_Y	61_R	0.631	0.20
115_N	147_I	0.627	0.20
86_A	146_V	0.625	0.19
172_G	182_P	0.625	0.19
131_G	146_V	0.623	0.19
115_N	121_G	0.621	0.19
116_S	156_T	0.619	0.19
38_N	54_A	0.615	0.19
85_Q	176_T	0.614	0.19
17_G	20_I	0.607	0.19
27_L	53_E	0.604	0.19
76_V	79_V	0.603	0.19
55_S	170_Q	0.602	0.19
81_L	167_V	0.602	0.19
19_L	43_L	0.600	0.19
64_I	109_T	0.598	0.18
94_L	98_T	0.596	0.18
49_A	59_S	0.593	0.18
31_I	52_E	0.592	0.18
9_D	42_Y	0.592	0.18
99_I	148_M	0.588	0.18
87_A	184_S	0.587	0.18
34_G	49_A	0.582	0.18
21_V	39_T	0.580	0.18
16_I	26_V	0.580	0.18
29_A	32_A	0.579	0.18
100_Q	176_T	0.578	0.18
83_V	115_N	0.573	0.18
129_I	133_N	0.573	0.18
42_Y	67_A	0.572	0.18
114_S	134_A	0.572	0.18
17_G	22_F	0.571	0.18
75_K	188_K	0.569	0.17
56_A	140_Q	0.569	0.17
165_L	175_T	0.568	0.17
137_L	164_Q	0.567	0.17
46_K	54_A	0.565	0.17
25_M	180_H	0.564	0.17
53_E	57_Q	0.559	0.17
18_T	41_G	0.555	0.17
115_N	118_S	0.553	0.17
35_V	38_N	0.551	0.17
129_I	143_R	0.550	0.17
68_Y	187_D	0.543	0.17
125_T	128_S	0.541	0.17
22_F	43_L	0.538	0.16
21_V	87_A	0.538	0.16
52_E	102_I	0.537	0.16
93_N	140_Q	0.528	0.16
42_Y	49_A	0.526	0.16
124_F	147_I	0.525	0.16
12_G	23_I	0.524	0.16
22_F	58_V	0.524	0.16
99_I	171_Y	0.523	0.16
45_S	61_R	0.521	0.16
56_A	112_Y	0.515	0.16
60_N	163_V	0.514	0.16
177_Y	186_K	0.513	0.16
149_Y	158_G	0.513	0.16
95_T	134_A	0.510	0.16
137_L	162_E	0.508	0.15
55_S	178_W	0.507	0.15
133_N	138_V	0.507	0.15
16_I	20_I	0.503	0.15
68_Y	103_G	0.501	0.15
64_I	91_N	0.500	0.15
113_S	151_S	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ncxA	1	0.5337	9.2	0.961	Contact Map
2l8aA	1	0.6425	7.5	0.963	Contact Map
2kxtA	1	0.544	6	0.964	Contact Map
2ra1A	1	0.9378	5.6	0.965	Contact Map
3ibzA	1	0.544	5.5	0.965	Contact Map
2xbtA	1	0.6736	4.7	0.966	Contact Map
4ue3S	2	0.0311	4.3	0.967	Contact Map
2zy9A	2	0.3679	3.9	0.968	Contact Map
4b9fA	1	0.6632	3.4	0.969	Contact Map
2bpsA	1	0.1813	3.4	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.