FLAB2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLAB2 - Flagellin B2

UniProt:	P13077	Sequences: MFEFITDEDERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGYLQSKGSATGEEASAQVSNRINIVSAYGNVDTSGSTEVVNYANLTVRQAAGADNINLSKSTIQWIGPDTATTLTYDGTTADAENFTTNSIKGDNADVLVDQSDRIEIVMDAAEITTNGLKAGEEVQLTVTTQYGSKTTYWANVPESLKDKNAVTL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (182)
Sequences:	315 (234)
Seq/√Len:	17.4

HALSA - FLAB2 FLAA1 FLAB1 FLAB3 FLAA2 Q9HQF9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
184_V	188_L	4.196	1.00
54_A	57_Q	4.128	1.00
133_G	137_D	3.934	1.00
70_N	81_N	3.845	1.00
42_Y	54_A	3.099	0.99
11_R	34_G	2.301	0.93
46_K	59_S	2.244	0.93
12_G	38_N	2.067	0.89
150_M	166_V	2.030	0.88
16_I	22_F	2.003	0.87
166_V	182_A	1.991	0.87
72_D	81_N	1.982	0.87
25_M	36_L	1.945	0.86
21_V	102_T	1.932	0.85
79_V	190_D	1.878	0.84
61_R	90_A	1.877	0.84
114_L	150_M	1.877	0.84
12_G	28_V	1.872	0.83
12_G	21_V	1.857	0.83
118_G	121_A	1.848	0.83
168_L	180_Y	1.825	0.82
14_V	68_Y	1.817	0.82
11_R	14_V	1.774	0.80
18_T	32_A	1.759	0.79
34_G	40_A	1.657	0.75
14_V	21_V	1.650	0.75
36_L	50_T	1.624	0.73
137_D	141_D	1.616	0.73
151_D	154_E	1.593	0.72
15_G	19_L	1.592	0.72
78_E	117_D	1.590	0.72
14_V	48_S	1.565	0.71
83_A	150_M	1.528	0.69
25_M	91_A	1.523	0.68
36_L	40_A	1.477	0.66
112_T	155_I	1.471	0.66
163_G	173_Q	1.463	0.65
172_T	184_V	1.457	0.65
16_I	24_A	1.450	0.64
117_D	151_D	1.446	0.64
57_Q	63_N	1.437	0.64
83_A	105_W	1.434	0.64
83_A	108_P	1.429	0.63
19_L	30_A	1.401	0.62
20_I	23_I	1.370	0.60
34_G	163_G	1.369	0.60
22_F	28_V	1.369	0.60
20_I	24_A	1.351	0.59
65_V	145_R	1.347	0.59
62_I	100_K	1.346	0.59
145_R	184_V	1.325	0.57
105_W	160_L	1.304	0.56
59_S	178_T	1.296	0.56
54_A	63_N	1.286	0.55
57_Q	172_T	1.286	0.55
40_A	49_A	1.285	0.55
31_I	46_K	1.281	0.55
31_I	40_A	1.271	0.54
135_N	141_D	1.246	0.53
8_E	93_A	1.236	0.52
40_A	86_T	1.224	0.51
22_F	26_V	1.223	0.51
21_V	36_L	1.217	0.51
99_S	191_K	1.187	0.49
12_G	42_Y	1.183	0.49
107_G	152_A	1.173	0.48
89_Q	93_A	1.168	0.48
27_L	41_G	1.164	0.48
49_A	181_W	1.150	0.47
125_N	153_A	1.141	0.46
40_A	188_L	1.137	0.46
15_G	22_F	1.136	0.46
12_G	22_F	1.130	0.46
38_N	42_Y	1.129	0.46
42_Y	57_Q	1.125	0.45
116_Y	138_V	1.112	0.45
52_E	56_A	1.109	0.44
129_N	149_V	1.106	0.44
26_V	41_G	1.101	0.44
64_I	95_N	1.085	0.43
12_G	53_E	1.080	0.43
85_L	156_T	1.077	0.42
42_Y	52_E	1.070	0.42
61_R	178_T	1.066	0.42
28_V	53_E	1.066	0.42
55_S	172_T	1.060	0.41
90_A	172_T	1.056	0.41
116_Y	126_F	1.047	0.41
55_S	59_S	1.046	0.41
138_V	141_D	1.042	0.40
132_K	136_A	1.040	0.40
168_L	182_A	1.035	0.40
73_T	76_S	1.031	0.40
129_N	147_E	1.031	0.40
106_I	166_V	1.026	0.39
172_T	188_L	1.023	0.39
133_G	165_E	1.022	0.39
135_N	144_D	1.018	0.39
15_G	18_T	1.017	0.39
125_N	154_E	1.015	0.39
46_K	55_S	1.008	0.38
89_Q	168_L	1.003	0.38
174_Y	177_K	1.000	0.38
85_L	150_M	0.987	0.37
144_D	185_P	0.987	0.37
12_G	132_K	0.983	0.37
21_V	71_V	0.982	0.37
135_N	162_A	0.969	0.36
42_Y	188_L	0.964	0.36
52_E	139_L	0.962	0.36
58_V	131_I	0.955	0.35
123_A	153_A	0.950	0.35
14_V	147_E	0.947	0.35
136_A	157_T	0.941	0.35
73_T	117_D	0.933	0.34
102_T	148_I	0.930	0.34
14_V	34_G	0.926	0.34
35_V	40_A	0.925	0.34
21_V	42_Y	0.921	0.34
26_V	53_E	0.919	0.33
14_V	167_Q	0.916	0.33
9_D	52_E	0.913	0.33
141_D	163_G	0.905	0.33
45_S	179_T	0.905	0.33
26_V	55_S	0.905	0.33
127_T	149_V	0.894	0.32
49_A	63_N	0.891	0.32
64_I	180_Y	0.889	0.32
119_T	125_N	0.888	0.32
46_K	50_T	0.886	0.32
26_V	39_T	0.886	0.32
42_Y	64_I	0.879	0.31
88_R	183_N	0.877	0.31
19_L	22_F	0.873	0.31
128_T	132_K	0.873	0.31
136_A	162_A	0.869	0.31
34_G	46_K	0.868	0.31
133_G	162_A	0.861	0.30
18_T	26_V	0.858	0.30
152_A	155_I	0.844	0.30
126_F	133_G	0.843	0.30
16_I	21_V	0.820	0.28
120_T	123_A	0.819	0.28
18_T	30_A	0.817	0.28
42_Y	142_Q	0.814	0.28
53_E	73_T	0.809	0.28
129_N	148_I	0.809	0.28
42_Y	63_N	0.800	0.27
120_T	191_K	0.794	0.27
155_I	159_G	0.788	0.27
61_R	172_T	0.788	0.27
112_T	171_T	0.786	0.27
45_S	60_N	0.783	0.27
143_S	172_T	0.781	0.27
9_D	49_A	0.771	0.26
95_N	139_L	0.754	0.25
116_Y	144_D	0.751	0.25
45_S	94_D	0.745	0.25
14_V	18_T	0.741	0.25
25_M	32_A	0.739	0.25
117_D	121_A	0.736	0.24
17_G	20_I	0.734	0.24
31_I	188_L	0.734	0.24
34_G	48_S	0.730	0.24
49_A	52_E	0.728	0.24
14_V	66_S	0.724	0.24
28_V	150_M	0.721	0.24
87_V	171_T	0.721	0.24
29_A	32_A	0.718	0.24
167_Q	171_T	0.717	0.24
89_Q	95_N	0.712	0.23
55_S	61_R	0.710	0.23
144_D	170_V	0.707	0.23
41_G	176_S	0.706	0.23
24_A	35_V	0.704	0.23
17_G	22_F	0.704	0.23
11_R	38_N	0.695	0.23
81_N	123_A	0.692	0.23
103_I	174_Y	0.692	0.23
101_S	132_K	0.687	0.22
88_R	176_S	0.686	0.22
90_A	168_L	0.685	0.22
86_T	89_Q	0.682	0.22
18_T	38_N	0.682	0.22
49_A	55_S	0.679	0.22
12_G	26_V	0.677	0.22
96_I	171_T	0.675	0.22
39_T	43_L	0.671	0.22
42_Y	49_A	0.666	0.21
117_D	161_K	0.665	0.21
133_G	144_D	0.661	0.21
27_L	53_E	0.661	0.21
186_E	190_D	0.658	0.21
97_N	179_T	0.657	0.21
31_I	52_E	0.657	0.21
21_V	91_A	0.657	0.21
62_I	96_I	0.656	0.21
164_E	188_L	0.656	0.21
110_T	170_V	0.654	0.21
173_Q	180_Y	0.653	0.21
119_T	122_D	0.644	0.21
130_S	133_G	0.642	0.20
105_W	166_V	0.640	0.20
46_K	64_I	0.639	0.20
57_Q	68_Y	0.639	0.20
24_A	33_A	0.638	0.20
25_M	187_S	0.635	0.20
73_T	159_G	0.632	0.20
79_V	159_G	0.622	0.20
16_I	20_I	0.621	0.20
12_G	23_I	0.621	0.20
170_V	180_Y	0.620	0.20
45_S	88_R	0.613	0.19
17_G	25_M	0.611	0.19
71_V	83_A	0.608	0.19
77_T	123_A	0.607	0.19
73_T	81_N	0.607	0.19
113_T	147_E	0.607	0.19
164_E	184_V	0.607	0.19
127_T	138_V	0.606	0.19
11_R	52_E	0.602	0.19
134_D	163_G	0.602	0.19
72_D	124_E	0.600	0.19
48_S	57_Q	0.600	0.19
56_A	142_Q	0.599	0.19
78_E	81_N	0.599	0.19
20_I	92_G	0.598	0.19
41_G	55_S	0.598	0.19
15_G	24_A	0.589	0.18
89_Q	96_I	0.585	0.18
40_A	51_G	0.584	0.18
56_A	116_Y	0.580	0.18
80_V	152_A	0.580	0.18
111_A	171_T	0.579	0.18
133_G	141_D	0.579	0.18
41_G	50_T	0.572	0.18
121_A	151_D	0.570	0.18
95_N	140_V	0.569	0.18
15_G	23_I	0.563	0.18
9_D	42_Y	0.563	0.18
115_T	159_G	0.556	0.17
16_I	23_I	0.553	0.17
21_V	54_A	0.552	0.17
26_V	38_N	0.548	0.17
10_E	13_Q	0.547	0.17
109_D	191_K	0.545	0.17
148_I	152_A	0.543	0.17
64_I	103_I	0.543	0.17
85_L	180_Y	0.538	0.17
67_A	162_A	0.538	0.17
122_D	127_T	0.536	0.17
15_G	20_I	0.532	0.16
68_Y	190_D	0.532	0.16
65_V	112_T	0.529	0.16
71_V	81_N	0.529	0.16
81_N	161_K	0.528	0.16
114_L	169_T	0.528	0.16
64_I	114_L	0.522	0.16
157_T	191_K	0.521	0.16
31_I	184_V	0.515	0.16
19_L	43_L	0.513	0.16
180_Y	183_N	0.506	0.16
131_I	140_V	0.505	0.16
114_L	141_D	0.505	0.16
80_V	83_A	0.504	0.16
61_R	177_K	0.504	0.16
148_I	170_V	0.503	0.16
159_G	164_E	0.503	0.16
64_I	113_T	0.502	0.16
132_K	135_N	0.501	0.15
85_L	105_W	0.501	0.15
128_T	135_N	0.500	0.15
118_G	161_K	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m8rA	4	0.3265	10.5	0.961	Contact Map
3ibzA	1	0.5561	8.9	0.962	Contact Map
2kxtA	1	0.5612	7.8	0.963	Contact Map
4b9fA	1	0.6531	6.5	0.964	Contact Map
4ue3S	2	0.0306	5.1	0.966	Contact Map
2l8aA	1	0.648	5.1	0.966	Contact Map
2zy9A	2	0.3571	5	0.966	Contact Map
1yq8A	3	0.4286	4.8	0.967	Contact Map
1wlhA	2	0.4082	4.6	0.967	Contact Map
2yrlA	1	0.4847	3.8	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.