FLAA2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLAA2 - Flagellin A2

UniProt:	P13075	Sequences: MFEFITDEDERGQVGIGTLIVFIAMVLVAAIAAGVLINTAGFLQSKGSATGEEASAQVSNRINIVSAYGNVNNEEVDYVNLTVRQAAGADNINLSKSTIQWIGPDKATTLTHANAADKTTLGEEFNTTSIKGNNDNVLVQQSDRIKVIMYAGGVSSKLGAGDEVQLTVTTQYGSKTTYWANVPESLKDKNAVKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	194 (182)
Sequences:	306 (231)
Seq/√Len:	17.2

HALSA - FLAA2 FLAB3 FLAB1 FLAA1 FLAB2 Q9HQF9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_A	57_Q	4.447	1.00
70_N	77_D	4.269	1.00
182_V	186_L	4.118	1.00
42_F	54_A	3.161	0.99
11_R	34_G	2.400	0.95
46_K	59_S	2.354	0.94
150_Y	153_G	2.308	0.93
149_M	164_V	2.297	0.93
11_R	14_V	2.089	0.89
12_G	38_N	2.082	0.89
140_Q	161_G	1.976	0.86
12_G	28_V	1.929	0.85
16_I	22_F	1.908	0.84
21_V	98_T	1.896	0.84
61_R	86_A	1.859	0.83
12_G	21_V	1.813	0.81
57_Q	63_N	1.782	0.80
112_H	137_V	1.779	0.80
18_T	32_A	1.777	0.80
14_V	21_V	1.752	0.79
164_V	180_A	1.749	0.78
62_I	96_K	1.704	0.77
14_V	48_S	1.695	0.76
14_V	68_Y	1.695	0.76
40_A	82_T	1.662	0.75
19_L	30_A	1.614	0.72
144_R	182_V	1.612	0.72
25_M	36_L	1.610	0.72
131_K	134_N	1.599	0.72
79_V	149_M	1.569	0.70
73_N	123_E	1.565	0.70
55_S	59_S	1.555	0.70
161_G	171_Q	1.540	0.69
25_M	87_A	1.528	0.68
34_G	40_A	1.498	0.67
34_G	161_G	1.495	0.66
166_L	178_Y	1.492	0.66
31_I	40_A	1.445	0.64
22_F	28_V	1.444	0.64
64_I	178_Y	1.434	0.63
79_V	104_P	1.433	0.63
15_G	19_L	1.432	0.63
52_E	56_A	1.405	0.61
101_W	158_L	1.391	0.61
36_L	40_A	1.384	0.60
79_V	101_W	1.381	0.60
36_L	50_T	1.379	0.60
59_S	176_T	1.335	0.57
22_F	26_V	1.306	0.56
110_L	149_M	1.298	0.55
120_T	135_D	1.289	0.55
42_F	52_E	1.287	0.55
132_G	143_D	1.258	0.53
8_E	89_A	1.242	0.52
170_T	182_V	1.237	0.52
31_I	46_K	1.236	0.52
172_Y	175_K	1.231	0.51
16_I	24_A	1.228	0.51
75_E	188_D	1.204	0.50
116_A	153_G	1.203	0.50
12_G	42_F	1.202	0.49
46_K	55_S	1.193	0.49
166_L	180_A	1.187	0.49
20_I	24_A	1.184	0.48
116_A	123_E	1.184	0.48
42_F	63_N	1.179	0.48
85_Q	166_L	1.170	0.48
113_A	150_Y	1.170	0.48
20_I	23_I	1.168	0.47
54_A	63_N	1.162	0.47
14_V	34_G	1.157	0.47
49_A	55_S	1.156	0.47
27_L	41_G	1.143	0.46
38_N	42_F	1.137	0.46
105_D	116_A	1.128	0.45
72_N	123_E	1.096	0.43
28_V	53_E	1.094	0.43
26_V	41_G	1.087	0.43
42_F	57_Q	1.082	0.42
86_A	170_T	1.081	0.42
12_G	22_F	1.069	0.42
46_K	64_I	1.061	0.41
40_A	49_A	1.053	0.41
57_Q	170_T	1.051	0.41
72_N	83_V	1.049	0.40
14_V	146_K	1.047	0.40
128_T	148_I	1.044	0.40
85_Q	89_A	1.043	0.40
142_S	147_V	1.040	0.40
102_I	164_V	1.037	0.40
12_G	53_E	1.019	0.39
11_R	52_E	1.018	0.39
49_A	63_N	1.004	0.38
41_G	174_S	1.002	0.38
118_K	121_L	0.994	0.37
9_D	52_E	0.989	0.37
26_V	39_T	0.988	0.37
84_R	181_N	0.987	0.37
18_T	30_A	0.981	0.37
95_S	189_K	0.979	0.36
26_V	55_S	0.976	0.36
173_G	183_P	0.976	0.36
15_G	22_F	0.962	0.36
45_S	60_N	0.959	0.35
83_V	114_N	0.959	0.35
21_V	71_V	0.959	0.35
77_D	155_S	0.954	0.35
168_V	178_Y	0.952	0.35
73_N	145_I	0.949	0.35
165_Q	169_T	0.949	0.35
61_R	176_T	0.942	0.34
55_S	61_R	0.930	0.34
65_V	108_T	0.929	0.34
121_L	149_M	0.925	0.33
101_W	164_V	0.923	0.33
171_Q	178_Y	0.920	0.33
65_V	144_R	0.914	0.33
99_I	145_I	0.911	0.33
74_E	149_M	0.910	0.33
46_K	50_T	0.906	0.32
12_G	26_V	0.906	0.32
64_I	110_L	0.904	0.32
130_I	134_N	0.897	0.32
34_G	48_S	0.891	0.32
92_I	169_T	0.888	0.32
83_V	107_A	0.888	0.32
81_L	149_M	0.878	0.31
40_A	90_D	0.873	0.31
9_D	49_A	0.870	0.31
126_N	137_V	0.867	0.30
26_V	53_E	0.862	0.30
81_L	101_W	0.860	0.30
64_I	99_I	0.857	0.30
162_D	186_L	0.855	0.30
98_T	147_V	0.855	0.30
12_G	131_K	0.850	0.30
41_G	50_T	0.842	0.29
42_F	64_I	0.841	0.29
18_T	26_V	0.836	0.29
21_V	42_F	0.832	0.29
112_H	143_D	0.832	0.29
15_G	18_T	0.829	0.29
103_G	151_A	0.824	0.28
106_K	168_V	0.822	0.28
14_V	18_T	0.821	0.28
72_N	152_G	0.818	0.28
74_E	101_W	0.818	0.28
62_I	92_I	0.814	0.28
56_A	141_Q	0.811	0.28
64_I	91_N	0.810	0.28
132_G	160_A	0.809	0.28
21_V	36_L	0.803	0.27
138_L	165_Q	0.802	0.27
14_V	66_S	0.800	0.27
126_N	131_K	0.798	0.27
26_V	38_N	0.792	0.27
35_V	40_A	0.783	0.26
108_T	113_A	0.783	0.26
73_N	117_D	0.779	0.26
117_D	121_L	0.776	0.26
41_G	55_S	0.775	0.26
40_A	186_L	0.771	0.26
178_Y	181_N	0.770	0.26
110_L	127_T	0.765	0.26
86_A	166_L	0.760	0.25
42_F	186_L	0.758	0.25
49_A	179_W	0.755	0.25
48_S	57_Q	0.755	0.25
144_R	170_T	0.752	0.25
49_A	59_S	0.749	0.25
77_D	159_G	0.747	0.25
121_L	125_F	0.746	0.25
18_T	38_N	0.742	0.24
112_H	125_F	0.740	0.24
61_R	85_Q	0.735	0.24
161_G	172_Y	0.735	0.24
119_T	126_N	0.726	0.24
60_N	67_A	0.714	0.23
45_S	177_T	0.713	0.23
72_N	105_D	0.713	0.23
24_A	33_A	0.710	0.23
25_M	32_A	0.710	0.23
110_L	167_T	0.710	0.23
10_E	62_I	0.709	0.23
143_D	168_V	0.704	0.23
97_S	149_M	0.704	0.23
31_I	52_E	0.703	0.23
42_F	46_K	0.703	0.23
39_T	43_L	0.694	0.22
89_A	174_S	0.694	0.22
56_A	97_S	0.692	0.22
60_N	140_Q	0.690	0.22
134_N	140_Q	0.688	0.22
134_N	143_D	0.688	0.22
74_E	147_V	0.687	0.22
105_D	121_L	0.687	0.22
70_N	189_K	0.686	0.22
136_N	150_Y	0.686	0.22
38_N	54_A	0.685	0.22
144_R	161_G	0.682	0.22
19_L	22_F	0.680	0.22
64_I	152_G	0.678	0.22
79_V	116_A	0.677	0.22
157_K	189_K	0.676	0.22
129_S	132_G	0.675	0.22
34_G	49_A	0.670	0.21
82_T	85_Q	0.668	0.21
99_I	151_A	0.668	0.21
16_I	21_V	0.667	0.21
21_V	54_A	0.666	0.21
42_F	49_A	0.665	0.21
55_S	179_W	0.661	0.21
79_V	108_T	0.659	0.21
110_L	169_T	0.655	0.21
55_S	170_T	0.654	0.21
114_N	117_D	0.653	0.21
118_K	135_D	0.651	0.21
170_T	186_L	0.647	0.21
24_A	35_V	0.643	0.20
124_E	155_S	0.633	0.20
27_L	53_E	0.627	0.20
42_F	61_R	0.623	0.20
45_S	50_T	0.609	0.19
40_A	45_S	0.605	0.19
85_Q	177_T	0.603	0.19
40_A	134_N	0.599	0.19
21_V	156_S	0.597	0.19
45_S	61_R	0.593	0.18
76_V	79_V	0.593	0.18
68_Y	188_D	0.593	0.18
65_V	153_G	0.592	0.18
29_A	32_A	0.592	0.18
68_Y	103_G	0.587	0.18
91_N	138_L	0.583	0.18
120_T	123_E	0.579	0.18
102_I	137_V	0.578	0.18
59_S	66_S	0.577	0.18
160_A	165_Q	0.573	0.18
117_D	150_Y	0.573	0.18
40_A	51_G	0.573	0.18
72_N	113_A	0.573	0.18
81_L	141_Q	0.571	0.18
123_E	133_N	0.570	0.18
65_V	68_Y	0.567	0.18
16_I	26_V	0.566	0.18
114_N	135_D	0.562	0.17
166_L	176_T	0.560	0.17
84_R	174_S	0.555	0.17
125_F	171_Q	0.555	0.17
113_A	123_E	0.553	0.17
79_V	151_A	0.549	0.17
85_Q	92_I	0.546	0.17
11_R	38_N	0.544	0.17
130_I	153_G	0.544	0.17
19_L	43_L	0.539	0.17
31_I	186_L	0.538	0.17
184_E	188_D	0.533	0.16
78_Y	119_T	0.533	0.16
55_S	171_Q	0.531	0.16
76_V	150_Y	0.529	0.16
115_A	123_E	0.529	0.16
21_V	39_T	0.529	0.16
92_I	174_S	0.528	0.16
17_G	20_I	0.527	0.16
131_K	143_D	0.525	0.16
62_I	169_T	0.523	0.16
11_R	45_S	0.515	0.16
163_E	179_W	0.512	0.16
31_I	61_R	0.506	0.16
126_N	148_I	0.503	0.15
83_V	121_L	0.501	0.15
22_F	43_L	0.500	0.15
52_E	102_I	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kxtA	1	0.5361	5.1	0.965	Contact Map
4ue3S	2	0.0309	5	0.966	Contact Map
3ibzA	1	0.5412	4.5	0.966	Contact Map
2l8aA	1	0.6443	4.3	0.967	Contact Map
2zy9A	2	0.3763	3.8	0.967	Contact Map
3ncxA	1	0.5309	3.7	0.968	Contact Map
3rb5A	2	0.6237	3.5	0.968	Contact Map
3uljA	3	0.4485	3.3	0.968	Contact Map
1c7sA	2	0.6082	3.2	0.969	Contact Map
2xbtA	1	0.6701	3.1	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.