RL15 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL15 - 50S ribosomal protein L15

UniProt:	P05971	Sequences: MTDKKRRQRGSRTHGGGTHKNRRGAGNRGGRGRAGRKKHEQHNYEDVGKSGFKRPEKTDRDVAVLSVQELDEDIPVLSESGVAEETEFGYRVDARDVVDDGWDADVVKVLGGGQLYEQLEVTADAFSDAAVELIEGEGGDAVVSERASEDDEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	153 (133)
Sequences:	451 (267)
Seq/√Len:	23.2

HALSA - RL15
SULSO - RL15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
126_F	141_A	5.229	1.00
94_A	109_V	5.162	1.00
5_K	8_Q	3.713	1.00
8_Q	14_H	2.978	1.00
123_A	126_F	2.968	1.00
54_R	58_T	2.919	0.99
132_E	136_G	2.768	0.99
129_A	132_E	2.662	0.99
16_G	22_R	2.406	0.98
109_V	126_F	2.221	0.96
109_V	123_A	2.218	0.96
54_R	57_K	2.174	0.96
54_R	62_V	2.124	0.95
33_R	44_Y	1.926	0.92
93_D	96_D	1.858	0.91
57_K	62_V	1.811	0.90
131_V	135_E	1.805	0.90
12_R	21_N	1.776	0.89
95_R	107_V	1.775	0.89
76_V	79_E	1.678	0.86
58_T	61_D	1.678	0.86
94_A	126_F	1.563	0.81
123_A	141_A	1.562	0.81
78_S	82_V	1.541	0.81
92_V	119_L	1.534	0.80
71_D	74_I	1.532	0.80
115_L	119_L	1.522	0.80
36_R	47_V	1.494	0.78
5_K	14_H	1.477	0.78
113_G	133_L	1.463	0.77
34_A	47_V	1.445	0.76
110_L	127_S	1.421	0.75
128_D	132_E	1.419	0.75
94_A	107_V	1.398	0.73
53_K	56_E	1.373	0.72
74_I	78_S	1.342	0.70
14_H	43_N	1.314	0.69
11_S	16_G	1.312	0.69
54_R	61_D	1.304	0.68
59_D	67_V	1.283	0.67
46_D	127_S	1.226	0.63
76_V	80_S	1.223	0.63
18_T	22_R	1.187	0.61
122_T	142_V	1.183	0.60
118_Q	136_G	1.167	0.59
8_Q	13_T	1.140	0.57
78_S	81_G	1.137	0.57
12_R	26_G	1.116	0.56
85_E	88_F	1.115	0.56
30_G	113_G	1.077	0.53
59_D	62_V	1.074	0.53
77_L	118_Q	1.066	0.52
119_L	128_D	1.048	0.51
44_Y	142_V	1.033	0.50
108_K	127_S	1.027	0.50
96_D	104_A	1.026	0.50
4_K	8_Q	1.004	0.48
109_V	141_A	0.998	0.48
11_S	14_H	0.996	0.47
85_E	89_G	0.983	0.47
67_V	81_G	0.982	0.46
67_V	70_L	0.980	0.46
16_G	21_N	0.970	0.46
45_E	127_S	0.959	0.45
33_R	42_H	0.957	0.45
42_H	75_P	0.948	0.44
77_L	83_A	0.941	0.44
7_R	29_G	0.933	0.43
9_R	23_R	0.928	0.43
54_R	59_D	0.926	0.43
118_Q	137_E	0.922	0.42
6_R	18_T	0.913	0.42
85_E	114_Q	0.912	0.42
10_G	22_R	0.900	0.41
120_E	132_E	0.898	0.41
13_T	16_G	0.896	0.41
109_V	115_L	0.891	0.40
121_V	134_I	0.887	0.40
31_R	51_G	0.885	0.40
107_V	124_D	0.879	0.39
3_D	8_Q	0.866	0.39
23_R	139_G	0.858	0.38
70_L	92_V	0.855	0.38
13_T	72_E	0.849	0.37
67_V	133_L	0.849	0.37
3_D	7_R	0.841	0.37
86_T	141_A	0.837	0.37
92_V	137_E	0.837	0.37
53_K	85_E	0.824	0.36
66_S	127_S	0.812	0.35
37_K	81_G	0.810	0.35
39_H	68_Q	0.798	0.34
77_L	81_G	0.792	0.34
23_R	29_G	0.791	0.34
32_G	51_G	0.790	0.34
6_R	10_G	0.789	0.34
35_G	139_G	0.780	0.33
88_F	136_G	0.779	0.33
60_R	124_D	0.777	0.33
6_R	20_K	0.771	0.33
5_K	43_N	0.769	0.32
19_H	111_G	0.761	0.32
94_A	141_A	0.758	0.32
86_T	89_G	0.757	0.32
23_R	138_G	0.754	0.31
89_G	140_D	0.749	0.31
5_K	121_V	0.741	0.31
3_D	142_V	0.740	0.31
21_N	36_R	0.738	0.31
17_G	110_L	0.735	0.30
16_G	27_N	0.733	0.30
8_Q	126_F	0.732	0.30
6_R	22_R	0.726	0.30
9_R	18_T	0.723	0.30
19_H	22_R	0.716	0.29
71_D	92_V	0.716	0.29
84_E	87_E	0.712	0.29
37_K	44_Y	0.704	0.29
35_G	130_A	0.692	0.28
75_P	83_A	0.691	0.28
75_P	81_G	0.690	0.28
106_V	112_G	0.689	0.28
18_T	21_N	0.687	0.28
37_K	47_V	0.686	0.28
75_P	78_S	0.684	0.27
40_E	45_E	0.678	0.27
82_V	87_E	0.677	0.27
12_R	16_G	0.676	0.27
71_D	77_L	0.676	0.27
54_R	127_S	0.676	0.27
30_G	130_A	0.670	0.27
78_S	87_E	0.668	0.27
91_R	136_G	0.665	0.26
38_K	52_F	0.662	0.26
21_N	27_N	0.662	0.26
61_D	129_A	0.661	0.26
27_N	123_A	0.661	0.26
78_S	119_L	0.656	0.26
58_T	62_V	0.654	0.26
3_D	6_R	0.651	0.26
65_L	109_V	0.650	0.26
104_A	114_Q	0.649	0.26
33_R	140_D	0.646	0.25
42_H	93_D	0.642	0.25
55_P	64_V	0.638	0.25
80_S	83_A	0.634	0.25
75_P	142_V	0.633	0.25
94_A	104_A	0.633	0.25
81_G	133_L	0.632	0.25
94_A	106_V	0.629	0.24
94_A	123_A	0.622	0.24
85_E	119_L	0.622	0.24
36_R	105_D	0.621	0.24
10_G	23_R	0.618	0.24
108_K	113_G	0.613	0.24
77_L	88_F	0.612	0.24
10_G	111_G	0.596	0.23
118_Q	140_D	0.595	0.23
33_R	112_G	0.595	0.23
55_P	132_E	0.593	0.23
18_T	138_G	0.590	0.23
80_S	84_E	0.589	0.22
61_D	136_G	0.587	0.22
66_S	133_L	0.585	0.22
58_T	137_E	0.581	0.22
40_E	43_N	0.581	0.22
66_S	112_G	0.574	0.22
87_E	129_A	0.574	0.22
70_L	78_S	0.571	0.22
88_F	141_A	0.570	0.22
63_A	135_E	0.570	0.22
90_Y	94_A	0.568	0.21
37_K	40_E	0.566	0.21
38_K	55_P	0.565	0.21
42_H	124_D	0.564	0.21
17_G	108_K	0.552	0.21
93_D	131_V	0.550	0.21
9_R	121_V	0.547	0.20
10_G	17_G	0.546	0.20
21_N	123_A	0.544	0.20
23_R	130_A	0.536	0.20
74_I	92_V	0.534	0.20
35_G	113_G	0.533	0.20
116_Y	131_V	0.525	0.20
41_Q	45_E	0.524	0.19
29_G	138_G	0.524	0.19
38_K	68_Q	0.518	0.19
50_S	54_R	0.516	0.19
32_G	35_G	0.514	0.19
75_P	104_A	0.512	0.19
82_V	125_A	0.510	0.19
66_S	110_L	0.508	0.19
22_R	27_N	0.508	0.19
15_G	138_G	0.508	0.19
12_R	55_P	0.507	0.19
84_E	89_G	0.507	0.19
70_L	73_D	0.505	0.19
54_R	69_E	0.501	0.18
113_G	139_G	0.501	0.18
81_G	85_E	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j21L	1	0.8889	100	0.361	Contact Map
1vq8L	1	0.9477	100	0.372	Contact Map
4w20a	1	0.8824	100	0.374	Contact Map
4a17K	1	0.902	100	0.379	Contact Map
3zf7b	1	0.8824	100	0.391	Contact Map
1vx7O	1	0.8889	100	0.401	Contact Map
3j61a	1	0.8627	100	0.413	Contact Map
4ujrN	1	0.8889	100	0.418	Contact Map
3bboN	1	0.9542	99.9	0.565	Contact Map
3j7yM	1	0.9216	99.9	0.632	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.