RL11 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL11 - 50S ribosomal protein L11

UniProt:	P05969	Sequences: MAETIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEAFDGTEVPVTIEYEDDGSFSIEVGVPPTAALVKDEAGFDTGSGEPQENFVADLSIEQLKTIAEQKKPDLLAYDARNAAKEVAGTCASLGVTIEGEDARTFNERVDDGDYDDVLGDELAAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (135)
Sequences:	2429 (987)
Seq/√Len:	85.0

ECOLI - RL11
BACSU - RL11
HALSA - RL11
SULSO - RL11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_A	37_E	3.761	1.00
75_V	133_V	3.582	1.00
95_D	134_T	3.051	1.00
75_V	96_L	3.041	1.00
40_D	43_E	2.952	1.00
102_K	106_E	2.895	1.00
98_I	125_A	2.579	1.00
3_E	27_T	2.469	1.00
71_T	124_V	2.466	1.00
87_E	91_N	2.456	1.00
97_S	100_Q	2.415	1.00
102_K	121_A	2.401	1.00
78_E	103_T	2.242	1.00
22_P	26_P	2.185	1.00
29_V	56_Y	2.173	1.00
95_D	136_E	2.170	1.00
50_V	66_V	2.123	1.00
87_E	90_E	2.089	1.00
5_I	56_Y	2.028	1.00
79_A	96_L	1.734	1.00
37_E	41_Q	1.720	1.00
9_V	20_L	1.716	1.00
89_Q	92_F	1.708	1.00
48_T	73_A	1.703	1.00
99_E	102_K	1.689	1.00
83_T	86_G	1.560	1.00
92_F	134_T	1.557	1.00
101_L	125_A	1.528	1.00
101_L	121_A	1.518	1.00
13_Q	46_D	1.517	1.00
32_Q	36_Q	1.446	0.99
15_D	35_V	1.435	0.99
98_I	121_A	1.386	0.99
101_L	124_V	1.366	0.99
4_T	53_T	1.363	0.99
5_I	27_T	1.324	0.99
53_T	67_G	1.311	0.99
112_L	120_A	1.310	0.99
114_A	119_N	1.269	0.98
103_T	106_E	1.267	0.98
10_A	13_Q	1.252	0.98
85_S	89_Q	1.241	0.98
99_E	103_T	1.238	0.98
68_V	110_P	1.237	0.98
19_P	22_P	1.236	0.98
117_A	121_A	1.216	0.98
109_K	114_A	1.197	0.97
100_Q	103_T	1.172	0.97
122_K	125_A	1.162	0.97
121_A	125_A	1.141	0.97
116_D	119_N	1.141	0.97
86_G	91_N	1.118	0.96
75_V	79_A	1.109	0.96
109_K	120_A	1.104	0.96
48_T	77_D	1.090	0.96
73_A	76_K	1.087	0.95
115_Y	119_N	1.076	0.95
114_A	120_A	1.069	0.95
79_A	133_V	1.067	0.95
30_D	33_A	1.066	0.95
76_K	81_F	1.062	0.95
85_S	91_N	1.051	0.95
98_I	101_L	1.037	0.94
81_F	133_V	1.036	0.94
53_T	65_E	1.031	0.94
45_F	49_E	1.018	0.94
96_L	133_V	0.984	0.92
103_T	107_Q	0.982	0.92
105_A	117_A	0.976	0.92
45_F	50_V	0.974	0.92
102_K	117_A	0.972	0.92
26_P	31_V	0.962	0.91
38_I	53_T	0.944	0.91
75_V	128_C	0.935	0.90
98_I	102_K	0.926	0.90
10_A	49_E	0.905	0.89
76_K	83_T	0.897	0.88
72_A	127_T	0.897	0.88
49_E	73_A	0.895	0.88
79_A	94_A	0.893	0.88
71_T	96_L	0.893	0.88
68_V	71_T	0.893	0.88
33_A	36_Q	0.892	0.88
74_L	107_Q	0.883	0.88
29_V	61_S	0.856	0.86
78_E	107_Q	0.848	0.85
94_A	133_V	0.841	0.85
52_V	66_V	0.833	0.84
78_E	100_Q	0.831	0.84
9_V	49_E	0.827	0.84
32_Q	40_D	0.826	0.84
106_E	117_A	0.816	0.83
98_I	137_G	0.808	0.82
27_T	60_G	0.803	0.82
57_E	63_S	0.800	0.82
113_L	123_E	0.793	0.81
37_E	64_I	0.790	0.81
26_P	29_V	0.786	0.81
119_N	122_K	0.784	0.81
13_Q	82_D	0.776	0.80
41_Q	64_I	0.776	0.80
99_E	137_G	0.773	0.80
77_D	80_G	0.766	0.79
32_Q	35_V	0.765	0.79
32_Q	62_F	0.758	0.78
14_A	21_G	0.757	0.78
106_E	121_A	0.756	0.78
34_V	38_I	0.743	0.77
25_G	130_S	0.742	0.77
43_E	46_D	0.739	0.76
5_I	54_I	0.737	0.76
81_F	93_V	0.732	0.76
72_A	86_G	0.731	0.76
20_L	23_E	0.725	0.75
27_T	56_Y	0.725	0.75
72_A	89_Q	0.724	0.75
118_R	122_K	0.716	0.74
36_Q	40_D	0.714	0.74
79_A	93_V	0.712	0.74
5_I	29_V	0.710	0.74
68_V	109_K	0.703	0.73
20_L	64_I	0.698	0.72
126_G	130_S	0.698	0.72
78_E	104_I	0.696	0.72
9_V	38_I	0.694	0.72
13_Q	43_E	0.682	0.71
85_S	92_F	0.680	0.70
70_P	131_L	0.674	0.70
86_G	89_Q	0.664	0.69
38_I	49_E	0.664	0.69
75_V	104_I	0.662	0.68
38_I	58_D	0.661	0.68
97_S	136_E	0.660	0.68
76_K	84_G	0.655	0.67
112_L	123_E	0.654	0.67
41_Q	66_V	0.651	0.67
96_L	135_I	0.644	0.66
109_K	112_L	0.636	0.65
94_A	134_T	0.634	0.65
85_S	88_P	0.631	0.65
7_V	52_V	0.630	0.64
42_T	66_V	0.627	0.64
13_Q	47_G	0.620	0.63
37_E	62_F	0.612	0.62
15_D	31_V	0.612	0.62
69_P	74_L	0.611	0.62
7_V	20_L	0.609	0.62
83_T	91_N	0.601	0.61
119_N	123_E	0.600	0.61
65_E	110_P	0.597	0.60
63_S	66_V	0.594	0.60
118_R	121_A	0.592	0.60
23_E	56_Y	0.587	0.59
109_K	113_L	0.586	0.59
45_F	107_Q	0.586	0.59
32_Q	37_E	0.586	0.59
113_L	120_A	0.585	0.59
28_P	60_G	0.580	0.58
25_G	28_P	0.580	0.58
50_V	69_P	0.580	0.58
51_P	68_V	0.576	0.58
16_P	54_I	0.575	0.58
22_P	56_Y	0.573	0.57
37_E	40_D	0.569	0.57
101_L	115_Y	0.562	0.56
9_V	31_V	0.561	0.56
33_A	60_G	0.560	0.56
80_G	100_Q	0.558	0.55
27_T	127_T	0.555	0.55
116_D	121_A	0.551	0.54
7_V	22_P	0.551	0.54
60_G	66_V	0.551	0.54
57_E	61_S	0.550	0.54
79_A	101_L	0.549	0.54
45_F	48_T	0.546	0.54
32_Q	43_E	0.539	0.53
89_Q	93_V	0.538	0.53
12_G	126_G	0.537	0.52
88_P	92_F	0.537	0.52
9_V	66_V	0.536	0.52
24_L	29_V	0.530	0.52
99_E	107_Q	0.529	0.51
16_P	39_N	0.529	0.51
108_K	111_D	0.528	0.51
102_K	105_A	0.523	0.51
79_A	135_I	0.521	0.50
96_L	101_L	0.520	0.50
96_L	104_I	0.520	0.50
22_P	31_V	0.517	0.50
21_G	25_G	0.516	0.50
66_V	87_E	0.516	0.50
39_N	108_K	0.513	0.49
38_I	52_V	0.512	0.49
15_D	19_P	0.512	0.49
58_D	122_K	0.510	0.49
21_G	51_P	0.509	0.49
34_V	39_N	0.508	0.49
4_T	58_D	0.506	0.48
11_G	46_D	0.506	0.48
115_Y	122_K	0.504	0.48
8_L	70_P	0.500	0.48
31_V	36_Q	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j21H	1	0.8098	100	0.042	Contact Map
1vq8I	1	0.4294	100	0.049	Contact Map
3j61K	1	0.7669	100	0.099	Contact Map
3zf7M	1	0.8098	100	0.112	Contact Map
4w22K	1	0.9141	100	0.113	Contact Map
3j7yJ	1	0.8282	100	0.119	Contact Map
3bboK	1	0.8344	100	0.134	Contact Map
3egvB	1	0.4601	100	0.139	Contact Map
4tp9I	1	0.0123	100	0.143	Contact Map
1mmsA	1	0.816	100	0.147	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.