O54601 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O54601 - Uncharacterized protein

UniProt:	O54601	Sequences: MSDRHPAFMPLILVGGLIFGFGLAYSQMARPEVVLNFLQFEDFGLVFVMFGGAAVTGVTFFVAPRLLGRAPLTGDSFQRRLKSFDRNVLIGGAIFGVGWGLSGICPGAAYASLGIGNITILWALAGMFLGAYTQGFWRSHSQSRDASSAGAD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	152 (130)
Sequences:	1353 (950)
Seq/√Len:	83.3

HALSA - O54601

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_P	77_F	4.583	1.00
104_I	112_S	3.477	1.00
33_V	44_G	3.443	1.00
33_V	42_D	3.410	1.00
71_P	74_G	3.299	1.00
57_G	61_F	3.116	1.00
56_T	60_F	2.714	1.00
61_F	64_P	2.638	1.00
54_A	58_V	2.439	1.00
47_F	51_G	2.345	1.00
24_A	29_A	2.276	1.00
86_R	90_I	2.210	1.00
90_I	94_I	2.126	1.00
71_P	76_S	2.073	1.00
87_N	138_R	2.027	1.00
61_F	65_R	2.017	1.00
134_Q	138_R	1.999	1.00
104_I	120_I	1.907	1.00
123_A	127_M	1.793	1.00
58_V	61_F	1.776	1.00
53_A	58_V	1.759	1.00
74_G	78_Q	1.755	1.00
121_L	125_A	1.636	1.00
110_Y	124_L	1.617	1.00
13_L	20_G	1.599	1.00
88_V	92_G	1.571	1.00
33_V	49_M	1.557	1.00
31_P	44_G	1.527	1.00
23_L	53_A	1.474	0.99
63_A	77_F	1.451	0.99
84_F	89_L	1.443	0.99
22_G	28_M	1.331	0.99
71_P	75_D	1.319	0.99
23_L	108_A	1.288	0.98
20_G	24_A	1.279	0.98
109_A	124_L	1.272	0.98
56_T	64_P	1.256	0.98
113_L	124_L	1.236	0.98
58_V	62_V	1.182	0.97
114_G	120_I	1.182	0.97
119_T	122_W	1.171	0.97
38_L	108_A	1.165	0.97
28_M	48_V	1.155	0.97
11_L	14_V	1.150	0.96
131_A	134_Q	1.147	0.96
126_G	129_L	1.146	0.96
132_Y	136_F	1.141	0.96
118_I	121_L	1.137	0.96
93_A	97_V	1.136	0.96
12_I	15_G	1.119	0.96
128_F	131_A	1.113	0.96
60_F	79_R	1.108	0.96
127_M	131_A	1.102	0.96
49_M	53_A	1.100	0.95
26_S	47_F	1.087	0.95
89_L	93_A	1.080	0.95
74_G	77_F	1.073	0.95
109_A	127_M	1.058	0.94
84_F	88_V	1.056	0.94
13_L	24_A	1.044	0.94
85_D	89_L	1.041	0.94
13_L	17_L	1.035	0.94
23_L	38_L	1.021	0.93
23_L	111_A	0.997	0.92
29_A	112_S	0.992	0.92
116_G	131_A	0.991	0.92
55_V	59_T	0.984	0.92
33_V	36_N	0.966	0.91
85_D	92_G	0.966	0.91
62_V	72_L	0.942	0.90
64_P	69_R	0.931	0.90
102_S	123_A	0.916	0.89
50_F	53_A	0.907	0.88
112_S	120_I	0.898	0.88
80_R	85_D	0.894	0.88
21_F	25_Y	0.892	0.88
11_L	133_T	0.892	0.88
20_G	113_L	0.887	0.87
60_F	64_P	0.884	0.87
38_L	111_A	0.883	0.87
35_L	60_F	0.873	0.86
56_T	63_A	0.869	0.86
63_A	68_G	0.869	0.86
92_G	138_R	0.868	0.86
125_A	129_L	0.867	0.86
60_F	63_A	0.861	0.86
8_F	74_G	0.856	0.85
24_A	111_A	0.850	0.85
68_G	77_F	0.848	0.85
23_L	28_M	0.841	0.84
108_A	111_A	0.821	0.83
29_A	111_A	0.821	0.83
31_P	37_F	0.795	0.81
109_A	123_A	0.794	0.81
9_M	12_I	0.788	0.80
68_G	72_L	0.787	0.80
70_A	132_Y	0.786	0.80
23_L	64_P	0.782	0.80
17_L	134_Q	0.776	0.79
56_T	59_T	0.767	0.78
55_V	60_F	0.763	0.78
87_N	102_S	0.760	0.78
20_G	111_A	0.751	0.77
80_R	83_S	0.742	0.76
110_Y	113_L	0.736	0.75
25_Y	62_V	0.715	0.73
119_T	133_T	0.714	0.73
87_N	90_I	0.714	0.73
87_N	134_Q	0.713	0.73
8_F	126_G	0.708	0.73
113_L	120_I	0.706	0.72
122_W	125_A	0.705	0.72
104_I	124_L	0.703	0.72
10_P	76_S	0.690	0.71
20_G	30_R	0.688	0.70
21_F	24_A	0.686	0.70
89_L	137_W	0.685	0.70
22_G	49_M	0.683	0.70
79_R	102_S	0.680	0.70
10_P	136_F	0.677	0.69
13_L	19_F	0.676	0.69
19_F	23_L	0.669	0.68
132_Y	139_S	0.668	0.68
76_S	121_L	0.664	0.68
30_R	49_M	0.663	0.68
83_S	92_G	0.659	0.67
53_A	56_T	0.659	0.67
16_G	20_G	0.653	0.66
18_I	22_G	0.645	0.66
37_F	100_G	0.631	0.64
48_V	51_G	0.629	0.64
37_F	44_G	0.629	0.64
70_A	73_T	0.629	0.64
114_G	118_I	0.625	0.63
63_A	79_R	0.618	0.62
70_A	77_F	0.614	0.62
81_L	84_F	0.613	0.62
85_D	93_A	0.612	0.61
47_F	112_S	0.612	0.61
73_T	94_I	0.612	0.61
26_S	29_A	0.611	0.61
43_F	88_V	0.608	0.61
13_L	59_T	0.606	0.61
117_N	122_W	0.600	0.60
38_L	127_M	0.593	0.59
10_P	61_F	0.589	0.59
40_F	139_S	0.587	0.58
110_Y	119_T	0.584	0.58
69_R	90_I	0.584	0.58
128_F	132_Y	0.583	0.58
25_Y	46_V	0.579	0.57
14_V	86_R	0.578	0.57
38_L	47_F	0.573	0.56
135_G	138_R	0.570	0.56
60_F	92_G	0.570	0.56
47_F	50_F	0.569	0.56
27_Q	36_N	0.566	0.56
12_I	39_Q	0.560	0.55
36_N	41_E	0.558	0.55
39_Q	123_A	0.557	0.54
22_G	45_L	0.556	0.54
25_Y	69_R	0.556	0.54
30_R	44_G	0.555	0.54
27_Q	102_S	0.552	0.54
20_G	56_T	0.550	0.53
11_L	113_L	0.539	0.52
72_L	94_I	0.538	0.52
15_G	38_L	0.536	0.52
53_A	60_F	0.534	0.51
20_G	107_G	0.533	0.51
29_A	35_L	0.530	0.51
30_R	33_V	0.527	0.50
56_T	79_R	0.527	0.50
81_L	139_S	0.522	0.50
120_I	134_Q	0.520	0.49
29_A	32_E	0.519	0.49
10_P	129_L	0.516	0.49
117_N	120_I	0.515	0.49
24_A	27_Q	0.514	0.49
112_S	117_N	0.514	0.49
29_A	49_M	0.514	0.49
89_L	138_R	0.514	0.49
86_R	136_F	0.513	0.49
27_Q	33_V	0.510	0.48
38_L	109_A	0.508	0.48
48_V	107_G	0.507	0.48
101_L	104_I	0.506	0.48
52_G	56_T	0.505	0.48
10_P	13_L	0.504	0.47
14_V	46_V	0.503	0.47
23_L	60_F	0.501	0.47
57_G	94_I	0.501	0.47
31_P	127_M	0.501	0.47
55_V	58_V	0.500	0.47
73_T	132_Y	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ldsA	2	0.875	45.6	0.93	Contact Map
3wdoA	1	0.9079	29.8	0.937	Contact Map
4gc0A	1	0.9013	24.7	0.939	Contact Map
4j05A	3	0.8553	20.3	0.942	Contact Map
3o7qA	1	0.8882	18.3	0.943	Contact Map
3j1zP	8	0.9145	16.8	0.944	Contact Map
1pw4A	1	0.8421	9.9	0.949	Contact Map
4w6vA	1	0.8487	9.4	0.95	Contact Map
2l6wA	2	0.2566	9.1	0.95	Contact Map
4zw9A	1	0.8684	8.2	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.