O54562 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O54562 - Uncharacterized protein

UniProt:	O54562	Sequences: MVEVPESLQSLFSATVEKRGETYTLEVPQTEVDHGAISPGETYRIGVLTQRQSSTKTADERTAQEQPAPSERNSGPPTPPVTEGEVRDVTIETVGDQGDGIAKVERGYVVIIPGAQPGDEPTIEIDQVQENVAFASVVDTGPQSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	145 (133)
Sequences:	128 (92)
Seq/√Len:	7.9

HALSA - O54562 Q9HHF0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_P	85_E	2.602	0.78
108_Y	131_N	2.494	0.75
2_V	120_E	2.479	0.75
115_A	137_V	2.135	0.63
6_E	33_D	2.120	0.62
5_P	90_T	2.022	0.58
44_R	102_A	2.018	0.58
32_V	138_V	2.007	0.58
93_T	103_K	2.002	0.57
96_D	134_F	1.992	0.57
104_V	133_A	1.882	0.52
102_A	108_Y	1.844	0.51
110_V	125_I	1.805	0.49
55_T	68_A	1.803	0.49
124_E	128_V	1.763	0.48
97_Q	104_V	1.762	0.48
103_K	120_E	1.750	0.47
126_D	136_S	1.735	0.46
114_G	137_V	1.732	0.46
90_T	103_K	1.729	0.46
15_T	116_Q	1.721	0.46
14_A	30_T	1.701	0.45
96_D	132_V	1.655	0.43
2_V	93_T	1.601	0.41
10_S	31_E	1.596	0.41
123_I	129_Q	1.557	0.39
85_E	115_A	1.539	0.39
37_I	74_S	1.524	0.38
90_T	117_P	1.509	0.38
132_V	135_A	1.484	0.37
56_K	119_D	1.463	0.36
110_V	122_T	1.460	0.36
21_E	47_V	1.442	0.35
16_V	58_A	1.440	0.35
22_T	32_V	1.440	0.35
39_P	140_T	1.398	0.33
105_E	128_V	1.378	0.33
106_R	113_P	1.376	0.33
45_I	58_A	1.359	0.32
123_I	137_V	1.346	0.31
116_Q	119_D	1.337	0.31
115_A	138_V	1.332	0.31
2_V	90_T	1.327	0.31
5_P	97_Q	1.327	0.31
85_E	92_E	1.289	0.30
12_F	27_V	1.287	0.29
130_E	134_F	1.282	0.29
93_T	116_Q	1.253	0.28
103_K	119_D	1.243	0.28
19_R	55_T	1.237	0.28
32_V	54_S	1.222	0.27
21_E	37_I	1.218	0.27
90_T	93_T	1.209	0.27
88_D	134_F	1.166	0.26
37_I	139_D	1.151	0.25
43_Y	87_R	1.146	0.25
14_A	77_P	1.134	0.25
17_E	83_E	1.127	0.24
73_N	110_V	1.126	0.24
69_P	126_D	1.123	0.24
18_K	68_A	1.120	0.24
94_V	115_A	1.111	0.24
23_Y	32_V	1.110	0.24
53_S	114_G	1.105	0.24
91_I	137_V	1.093	0.23
33_D	118_G	1.092	0.23
16_V	76_P	1.082	0.23
10_S	121_P	1.082	0.23
5_P	26_E	1.076	0.23
115_A	126_D	1.057	0.22
87_R	105_E	1.053	0.22
122_T	134_F	1.048	0.22
42_T	124_E	1.042	0.22
96_D	135_A	1.033	0.22
47_V	120_E	1.030	0.22
90_T	120_E	1.025	0.21
57_T	69_P	1.014	0.21
88_D	103_K	1.014	0.21
34_H	121_P	1.012	0.21
6_E	126_D	0.995	0.21
46_G	113_P	0.994	0.21
96_D	122_T	0.989	0.20
90_T	130_E	0.976	0.20
87_R	106_R	0.973	0.20
29_Q	47_V	0.971	0.20
27_V	115_A	0.963	0.20
114_G	140_T	0.963	0.20
25_L	52_Q	0.951	0.19
19_R	130_E	0.949	0.19
52_Q	71_E	0.934	0.19
130_E	135_A	0.927	0.19
85_E	128_V	0.923	0.19
31_E	92_E	0.921	0.19
16_V	125_I	0.921	0.19
30_T	131_N	0.916	0.19
40_G	76_P	0.916	0.19
75_G	123_I	0.911	0.18
21_E	138_V	0.907	0.18
97_Q	133_A	0.892	0.18
36_A	77_P	0.892	0.18
90_T	119_D	0.878	0.18
88_D	96_D	0.874	0.18
79_P	131_N	0.870	0.17
5_P	24_T	0.857	0.17
54_S	69_P	0.855	0.17
24_T	27_V	0.854	0.17
46_G	50_Q	0.843	0.17
20_G	123_I	0.837	0.17
110_V	134_F	0.832	0.17
96_D	110_V	0.831	0.17
40_G	53_S	0.825	0.16
33_D	74_S	0.824	0.16
83_E	123_I	0.821	0.16
20_G	40_G	0.815	0.16
21_E	94_V	0.812	0.16
88_D	127_Q	0.806	0.16
27_V	139_D	0.804	0.16
49_T	55_T	0.802	0.16
7_S	103_K	0.788	0.16
119_D	140_T	0.781	0.15
87_R	124_E	0.777	0.15
88_D	132_V	0.775	0.15
122_T	132_V	0.758	0.15
40_G	122_T	0.755	0.15
14_A	85_E	0.749	0.15
48_L	83_E	0.743	0.15
37_I	51_R	0.742	0.15
68_A	71_E	0.738	0.15
83_E	134_F	0.736	0.15
11_L	90_T	0.734	0.14
12_F	124_E	0.733	0.14
22_T	51_R	0.732	0.14
25_L	126_D	0.729	0.14
74_S	139_D	0.729	0.14
32_V	71_E	0.722	0.14
31_E	131_N	0.717	0.14
67_P	124_E	0.693	0.14
25_L	38_S	0.687	0.14
90_T	127_Q	0.683	0.13
43_Y	124_E	0.680	0.13
19_R	72_R	0.676	0.13
47_V	125_I	0.669	0.13
3_E	37_I	0.660	0.13
58_A	68_A	0.659	0.13
49_T	54_S	0.651	0.13
81_V	102_A	0.645	0.13
78_T	132_V	0.644	0.13
78_T	88_D	0.643	0.13
71_E	118_G	0.640	0.13
110_V	132_V	0.640	0.13
24_T	105_E	0.636	0.13
87_R	128_V	0.635	0.13
26_E	57_T	0.633	0.13
27_V	30_T	0.627	0.12
15_T	41_E	0.627	0.12
24_T	57_T	0.622	0.12
13_S	83_E	0.619	0.12
66_Q	69_P	0.618	0.12
46_G	105_E	0.614	0.12
26_E	49_T	0.604	0.12
39_P	131_N	0.603	0.12
21_E	130_E	0.599	0.12
52_Q	115_A	0.598	0.12
116_Q	120_E	0.594	0.12
68_A	85_E	0.592	0.12
16_V	67_P	0.590	0.12
83_E	118_G	0.584	0.12
82_T	91_I	0.576	0.12
41_E	101_I	0.575	0.12
31_E	137_V	0.570	0.11
10_S	103_K	0.569	0.11
22_T	26_E	0.565	0.11
40_G	52_Q	0.563	0.11
88_D	135_A	0.561	0.11
14_A	31_E	0.560	0.11
40_G	51_R	0.557	0.11
17_E	135_A	0.555	0.11
48_L	134_F	0.552	0.11
52_Q	55_T	0.550	0.11
88_D	110_V	0.547	0.11
2_V	103_K	0.542	0.11
6_E	101_I	0.539	0.11
45_I	85_E	0.535	0.11
13_S	133_A	0.535	0.11
42_T	125_I	0.531	0.11
85_E	105_E	0.526	0.11
115_A	121_P	0.524	0.11
20_G	37_I	0.522	0.11
54_S	57_T	0.520	0.11
33_D	116_Q	0.517	0.11
16_V	40_G	0.516	0.11
34_H	93_T	0.515	0.11
122_T	125_I	0.513	0.11
105_E	110_V	0.513	0.11
3_E	90_T	0.510	0.11
7_S	123_I	0.505	0.10
6_E	53_S	0.505	0.10
54_S	77_P	0.502	0.10
27_V	52_Q	0.501	0.10
115_A	127_Q	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1yezA	1	0.469	99.2	0.793	Contact Map
1uwvA	1	0.4138	99.2	0.794	Contact Map
1yvcA	1	0.4828	99.1	0.802	Contact Map
2jjqA	1	0.3724	98.8	0.822	Contact Map
3waiA	1	0.4897	11.9	0.957	Contact Map
2wknA	5	0.669	9.4	0.959	Contact Map
3b5nC	1	0.3172	8.3	0.96	Contact Map
2mrnA	2	0.4138	7.2	0.961	Contact Map
3lzkA	2	0.6828	6.4	0.962	Contact Map
3pjyA	1	0.331	6.3	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.