O54559 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O54559 - Uncharacterized protein

UniProt:	O54559	Sequences: MVIDPLPLQVAAELFPNGISRYAIGGLLVGLGVTVIYLGTGISAGASTFLESTLSYVSDQSRFQQYVSSRDWRLVFTLGIVLGAAVYAVVYQGGAWTTDVQPWRLLVGGVFVGIGTRVGKGCTSGHGVCGVGSASKTSIVGVLAFLTVAIVTAQVVAALGVSP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (133)
Sequences:	1682 (1197)
Seq/√Len:	103.8

ECOLI - YEDE YEEE
HALSA - O54559
SULSO - Q97UD1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
131_V	139_I	3.998	1.00
114_I	118_V	3.195	1.00
44_A	76_F	3.075	1.00
29_V	128_V	2.995	1.00
52_S	73_R	2.916	1.00
131_V	142_V	2.844	1.00
146_L	150_I	2.609	1.00
53_T	74_L	2.372	1.00
24_I	27_L	2.170	1.00
43_S	129_C	2.143	1.00
144_A	148_V	2.138	1.00
19_I	22_Y	1.957	1.00
46_A	80_I	1.902	1.00
141_G	145_F	1.871	1.00
102_P	106_L	1.846	1.00
49_F	72_W	1.835	1.00
154_Q	158_A	1.819	1.00
20_S	24_I	1.797	1.00
35_V	39_G	1.796	1.00
82_L	85_A	1.758	1.00
36_I	72_W	1.745	1.00
147_T	151_V	1.716	1.00
126_H	138_S	1.683	1.00
69_S	72_W	1.650	1.00
139_I	143_L	1.638	1.00
140_V	144_A	1.582	1.00
51_E	117_R	1.561	1.00
26_G	30_G	1.529	1.00
132_G	136_K	1.470	1.00
34_T	38_L	1.462	1.00
47_S	117_R	1.443	1.00
52_S	69_S	1.433	1.00
149_A	156_V	1.401	1.00
103_W	106_L	1.394	1.00
113_G	145_F	1.370	1.00
49_F	73_R	1.332	0.99
143_L	147_T	1.331	0.99
131_V	144_A	1.261	0.99
102_P	105_L	1.254	0.99
48_T	133_S	1.246	0.99
43_S	48_T	1.244	0.99
97_T	101_Q	1.235	0.99
75_V	83_G	1.228	0.99
34_T	37_Y	1.218	0.99
67_V	70_R	1.201	0.99
114_I	117_R	1.201	0.99
101_Q	104_R	1.188	0.99
144_A	149_A	1.186	0.99
83_G	91_Y	1.180	0.99
88_A	92_Q	1.173	0.98
36_I	40_T	1.165	0.98
133_S	137_T	1.160	0.98
87_Y	90_V	1.149	0.98
27_L	88_A	1.133	0.98
30_G	127_G	1.124	0.98
153_A	157_A	1.105	0.98
100_V	104_R	1.104	0.98
46_A	116_T	1.098	0.98
27_L	31_L	1.094	0.98
70_R	74_L	1.088	0.98
99_D	102_P	1.088	0.98
87_Y	91_Y	1.078	0.97
23_A	27_L	1.071	0.97
97_T	100_V	1.065	0.97
47_S	149_A	1.060	0.97
81_V	85_A	1.053	0.97
116_T	129_C	1.038	0.97
69_S	73_R	1.021	0.96
97_T	102_P	0.989	0.96
46_A	76_F	0.986	0.96
100_V	108_G	0.985	0.96
28_L	31_L	0.985	0.96
85_A	106_L	0.960	0.95
83_G	92_Q	0.952	0.95
144_A	152_T	0.950	0.95
55_S	83_G	0.938	0.94
26_G	149_A	0.938	0.94
151_V	154_Q	0.932	0.94
127_G	142_V	0.924	0.94
112_V	145_F	0.917	0.93
30_G	153_A	0.900	0.93
115_G	126_H	0.898	0.93
126_H	130_G	0.888	0.92
152_T	155_V	0.876	0.92
33_V	148_V	0.874	0.92
41_G	113_G	0.867	0.91
146_L	153_A	0.858	0.91
29_V	142_V	0.857	0.91
18_G	22_Y	0.855	0.91
103_W	107_V	0.855	0.91
39_G	107_V	0.853	0.91
27_L	95_A	0.849	0.91
107_V	156_V	0.843	0.90
84_A	120_K	0.840	0.90
21_R	83_G	0.837	0.90
33_V	146_L	0.831	0.90
150_I	158_A	0.830	0.90
77_T	147_T	0.827	0.89
43_S	137_T	0.819	0.89
87_Y	119_G	0.818	0.89
84_A	98_T	0.817	0.89
20_S	87_Y	0.813	0.89
18_G	21_R	0.809	0.88
26_G	127_G	0.807	0.88
52_S	55_S	0.807	0.88
85_A	88_A	0.804	0.88
92_Q	96_W	0.799	0.88
70_R	82_L	0.789	0.87
33_V	145_F	0.784	0.87
130_G	138_S	0.767	0.86
34_T	40_T	0.765	0.85
104_R	108_G	0.764	0.85
33_V	129_C	0.764	0.85
106_L	113_G	0.760	0.85
38_L	82_L	0.752	0.84
68_S	136_K	0.750	0.84
75_V	79_G	0.748	0.84
126_H	137_T	0.746	0.84
78_L	83_G	0.745	0.84
44_A	128_V	0.740	0.83
77_T	116_T	0.733	0.83
126_H	141_G	0.727	0.82
138_S	145_F	0.726	0.82
36_I	44_A	0.725	0.82
50_L	81_V	0.722	0.82
32_G	76_F	0.707	0.81
47_S	126_H	0.700	0.80
98_T	148_V	0.697	0.80
43_S	133_S	0.693	0.79
48_T	76_F	0.680	0.78
120_K	137_T	0.679	0.78
93_G	103_W	0.677	0.78
98_T	105_L	0.669	0.77
24_I	31_L	0.667	0.77
46_A	111_F	0.665	0.76
83_G	87_Y	0.664	0.76
43_S	76_F	0.663	0.76
71_D	82_L	0.656	0.75
30_G	157_A	0.653	0.75
73_R	129_C	0.641	0.74
90_V	93_G	0.637	0.73
70_R	110_V	0.636	0.73
44_A	80_I	0.619	0.71
22_Y	128_V	0.619	0.71
119_G	136_K	0.614	0.71
127_G	146_L	0.612	0.70
36_I	49_F	0.612	0.70
31_L	90_V	0.611	0.70
25_G	112_V	0.610	0.70
32_G	105_L	0.609	0.70
27_L	118_V	0.607	0.70
98_T	101_Q	0.605	0.69
49_F	77_T	0.601	0.69
89_V	107_V	0.601	0.69
110_V	113_G	0.598	0.69
29_V	66_Y	0.596	0.68
29_V	141_G	0.596	0.68
19_I	120_K	0.589	0.67
114_I	140_V	0.588	0.67
46_A	77_T	0.588	0.67
32_G	35_V	0.587	0.67
71_D	78_L	0.587	0.67
99_D	107_V	0.584	0.67
20_S	23_A	0.579	0.66
86_V	100_V	0.576	0.66
140_V	152_T	0.575	0.66
93_G	147_T	0.573	0.65
136_K	139_I	0.572	0.65
37_Y	40_T	0.569	0.65
118_V	150_I	0.564	0.64
39_G	85_A	0.564	0.64
56_Y	108_G	0.560	0.64
129_C	158_A	0.550	0.62
107_V	147_T	0.550	0.62
100_V	103_W	0.549	0.62
51_E	56_Y	0.548	0.62
68_S	74_L	0.546	0.62
72_W	145_F	0.545	0.61
90_V	140_V	0.544	0.61
79_G	134_A	0.544	0.61
66_Y	86_V	0.543	0.61
25_G	133_S	0.539	0.61
55_S	117_R	0.539	0.61
129_C	146_L	0.537	0.60
136_K	156_V	0.537	0.60
56_Y	67_V	0.536	0.60
128_V	153_A	0.535	0.60
30_G	76_F	0.530	0.59
56_Y	70_R	0.528	0.59
93_G	151_V	0.526	0.59
55_S	68_S	0.525	0.59
40_T	120_K	0.524	0.58
72_W	75_V	0.522	0.58
46_A	131_V	0.520	0.58
87_Y	140_V	0.517	0.57
131_V	136_K	0.516	0.57
55_S	96_W	0.513	0.57
120_K	136_K	0.509	0.56
50_L	77_T	0.503	0.55
37_Y	47_S	0.500	0.55

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3llqA	3	0.5337	5.2	0.951	Contact Map
2f2bA	4	0.5337	4.3	0.953	Contact Map
3b5dA	2	0.5215	3.6	0.954	Contact Map
4p6vB	1	0.3681	3.3	0.955	Contact Map
2ls4A	1	0.1472	2.9	0.957	Contact Map
2o9gA	3	0.5337	2.6	0.958	Contact Map
3cn5A	3	0.5828	2.4	0.958	Contact Map
3gd8A	4	0.5276	2.4	0.958	Contact Map
4l6vF	1	0.2577	1.7	0.961	Contact Map
2wssS	1	0.1963	1.6	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.