O52012 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O52012 - Uncharacterized protein

UniProt:	O52012	Sequences: MAPAAAFDAISNSRRRRVVLSLSRSSGDVPVGDLAVEIAAIENELDPSKVGNNERASTYISLIQRHLDTLDGVSAVDYDDRSKTVTATDATEPLAEYIRRLQTACYKPDSEDAT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	114 (100)
Sequences:	542 (409)
Seq/√Len:	40.9

HALSA - O52012

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_E	41_I	5.251	1.00
87_A	91_T	4.288	1.00
14_R	42_E	3.499	1.00
17_R	20_L	3.162	1.00
15_R	66_H	2.780	1.00
45_L	54_E	2.738	1.00
21_S	29_V	2.609	1.00
51_G	54_E	2.590	1.00
59_Y	64_Q	2.518	1.00
17_R	41_I	2.493	1.00
12_N	64_Q	2.281	1.00
18_V	34_L	2.143	0.99
43_N	54_E	2.131	0.99
9_A	58_T	1.964	0.99
50_V	63_I	1.800	0.98
56_A	64_Q	1.553	0.95
84_T	87_A	1.449	0.93
55_R	58_T	1.442	0.93
64_Q	71_D	1.434	0.92
77_D	86_T	1.412	0.92
98_I	101_L	1.408	0.92
36_V	50_V	1.294	0.88
88_T	91_T	1.262	0.86
35_A	58_T	1.261	0.86
32_G	56_A	1.256	0.86
13_S	93_P	1.205	0.84
71_D	77_D	1.199	0.83
58_T	67_L	1.144	0.80
39_A	42_E	1.144	0.80
20_L	24_R	1.142	0.80
40_A	45_L	1.110	0.78
8_D	11_S	1.103	0.78
23_S	95_A	1.069	0.76
17_R	38_I	1.044	0.74
20_L	41_I	1.044	0.74
96_E	100_R	1.042	0.74
4_A	76_V	1.027	0.73
43_N	59_Y	1.022	0.72
36_V	55_R	1.015	0.72
16_R	39_A	1.015	0.72
9_A	75_A	1.009	0.71
17_R	60_I	0.993	0.70
8_D	69_T	0.980	0.69
19_V	37_E	0.971	0.68
39_A	64_Q	0.961	0.68
11_S	61_S	0.952	0.67
89_D	99_R	0.950	0.67
8_D	70_L	0.942	0.66
70_L	78_Y	0.912	0.63
77_D	88_T	0.903	0.63
30_P	38_I	0.895	0.62
81_R	84_T	0.889	0.61
35_A	73_V	0.889	0.61
32_G	82_S	0.888	0.61
34_L	80_D	0.878	0.60
19_V	80_D	0.870	0.60
22_L	30_P	0.867	0.59
80_D	83_K	0.855	0.58
35_A	52_N	0.844	0.57
38_I	58_T	0.841	0.57
35_A	80_D	0.831	0.56
74_S	99_R	0.829	0.56
27_G	84_T	0.827	0.56
3_P	64_Q	0.826	0.56
60_I	63_I	0.823	0.55
8_D	58_T	0.821	0.55
31_V	78_Y	0.815	0.55
30_P	35_A	0.813	0.55
40_A	50_V	0.811	0.54
29_V	87_A	0.803	0.54
5_A	99_R	0.802	0.54
36_V	47_P	0.802	0.54
61_S	65_R	0.798	0.53
50_V	54_E	0.791	0.53
14_R	58_T	0.785	0.52
28_D	77_D	0.782	0.52
32_G	64_Q	0.780	0.52
21_S	37_E	0.778	0.51
71_D	76_V	0.777	0.51
62_L	67_L	0.770	0.51
46_D	58_T	0.769	0.50
22_L	68_D	0.762	0.50
30_P	48_S	0.760	0.50
3_P	76_V	0.759	0.50
87_A	90_A	0.756	0.49
44_E	50_V	0.749	0.49
52_N	60_I	0.743	0.48
19_V	91_T	0.742	0.48
11_S	52_N	0.731	0.47
31_V	74_S	0.717	0.46
56_A	60_I	0.714	0.45
13_S	17_R	0.709	0.45
74_S	102_Q	0.706	0.45
25_S	77_D	0.694	0.44
38_I	45_L	0.691	0.43
3_P	68_D	0.681	0.42
54_E	57_S	0.678	0.42
12_N	17_R	0.676	0.42
21_S	69_T	0.675	0.42
63_I	101_L	0.672	0.42
30_P	92_E	0.671	0.41
12_N	57_S	0.667	0.41
57_S	64_Q	0.646	0.39
54_E	59_Y	0.643	0.39
57_S	98_I	0.643	0.39
33_D	47_P	0.641	0.39
60_I	92_E	0.639	0.39
96_E	101_L	0.636	0.38
63_I	69_T	0.629	0.38
67_L	97_Y	0.627	0.38
90_A	93_P	0.621	0.37
65_R	81_R	0.621	0.37
4_A	47_P	0.618	0.37
65_R	71_D	0.618	0.37
34_L	61_S	0.617	0.37
51_G	58_T	0.613	0.36
22_L	62_L	0.611	0.36
90_A	100_R	0.604	0.36
30_P	86_T	0.602	0.35
33_D	48_S	0.602	0.35
53_N	72_G	0.602	0.35
32_G	53_N	0.597	0.35
20_L	26_S	0.597	0.35
35_A	77_D	0.596	0.35
24_R	30_P	0.576	0.33
56_A	59_Y	0.575	0.33
26_S	44_E	0.572	0.33
45_L	69_T	0.561	0.32
52_N	83_K	0.560	0.32
9_A	86_T	0.560	0.32
64_Q	68_D	0.559	0.32
31_V	67_L	0.554	0.31
23_S	33_D	0.551	0.31
11_S	20_L	0.549	0.31
75_A	94_L	0.547	0.31
35_A	98_I	0.537	0.30
33_D	84_T	0.536	0.30
29_V	38_I	0.529	0.30
56_A	77_D	0.528	0.29
35_A	102_Q	0.527	0.29
4_A	77_D	0.525	0.29
33_D	93_P	0.522	0.29
24_R	37_E	0.520	0.29
65_R	69_T	0.519	0.29
9_A	73_V	0.516	0.29
70_L	77_D	0.516	0.29
49_K	73_V	0.512	0.28
61_S	70_L	0.506	0.28
18_V	98_I	0.504	0.28
19_V	23_S	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4k2eA	2	0.7368	96.6	0.802	Contact Map
1q1hA	1	0.6754	96.6	0.802	Contact Map
3pqkA	2	0.807	96.6	0.802	Contact Map
1r1tA	2	0.7719	96.6	0.802	Contact Map
2jscA	2	0.8158	96.5	0.804	Contact Map
3cuoA	2	0.7632	96.4	0.805	Contact Map
2kkoA	2	0.8246	96.4	0.806	Contact Map
2zkzA	2	0.7368	96.1	0.811	Contact Map
1r1uA	2	0.7895	96.1	0.811	Contact Map
1u2wA	2	0.7895	96.1	0.811	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.