O52006 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O52006 - Uncharacterized protein

UniProt:	O52006	Sequences: MHDLTGFQRDLLYAIAGLDEPHGLAVKDELENYYESEIHHGRLYPNLDTLVDKGLVEKGEIDQRTNSYALTRRGRRELTARREWEHQYVTLDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (87)
Sequences:	293 (130)
Seq/√Len:	13.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_R	85_E	2.890	0.97
41_G	45_P	2.604	0.94
81_R	85_E	2.598	0.94
40_H	43_L	2.328	0.89
73_R	77_E	2.168	0.85
24_L	30_L	2.156	0.85
38_I	52_D	2.136	0.84
22_H	25_A	1.989	0.80
61_I	67_S	1.984	0.80
5_T	74_G	1.981	0.80
31_E	38_I	1.973	0.79
6_G	9_R	1.785	0.72
53_K	76_R	1.781	0.72
73_R	76_R	1.771	0.71
15_I	28_D	1.688	0.67
59_G	67_S	1.688	0.67
6_G	10_D	1.670	0.66
45_P	58_K	1.607	0.63
19_D	87_Q	1.592	0.63
29_E	41_G	1.515	0.59
35_E	48_D	1.502	0.58
21_P	67_S	1.494	0.58
45_P	74_G	1.453	0.55
5_T	42_R	1.426	0.54
60_E	72_R	1.415	0.53
41_G	58_K	1.369	0.51
22_H	30_L	1.296	0.47
15_I	70_L	1.290	0.47
10_D	81_R	1.271	0.46
5_T	8_Q	1.251	0.45
58_K	84_W	1.222	0.43
38_I	73_R	1.204	0.42
13_Y	81_R	1.197	0.42
22_H	61_I	1.197	0.42
45_P	48_D	1.153	0.39
56_V	79_T	1.148	0.39
2_H	74_G	1.129	0.38
16_A	26_V	1.111	0.37
15_I	21_P	1.104	0.37
4_L	8_Q	1.084	0.36
29_E	80_A	1.065	0.35
8_Q	27_K	1.048	0.34
17_G	85_E	1.016	0.33
54_G	73_R	1.013	0.32
39_H	63_Q	0.997	0.32
35_E	78_L	0.992	0.31
9_R	49_T	0.966	0.30
77_E	80_A	0.965	0.30
15_I	56_V	0.946	0.29
17_G	21_P	0.941	0.29
81_R	84_W	0.925	0.28
2_H	35_E	0.914	0.28
20_E	69_A	0.908	0.28
49_T	53_K	0.908	0.28
20_E	56_V	0.907	0.28
29_E	55_L	0.902	0.27
45_P	49_T	0.885	0.27
34_Y	38_I	0.881	0.26
33_Y	84_W	0.877	0.26
9_R	21_P	0.866	0.26
56_V	75_R	0.865	0.26
68_Y	71_T	0.854	0.25
51_V	56_V	0.852	0.25
7_F	64_R	0.847	0.25
3_D	40_H	0.814	0.24
3_D	87_Q	0.812	0.24
74_G	79_T	0.807	0.23
29_E	33_Y	0.802	0.23
43_L	62_D	0.802	0.23
34_Y	39_H	0.794	0.23
6_G	21_P	0.793	0.23
4_L	31_E	0.781	0.22
48_D	74_G	0.780	0.22
23_G	66_N	0.765	0.22
19_D	26_V	0.765	0.22
38_I	59_G	0.765	0.22
18_L	56_V	0.749	0.21
82_R	86_H	0.745	0.21
20_E	70_L	0.730	0.21
58_K	81_R	0.726	0.20
15_I	18_L	0.722	0.20
80_A	85_E	0.695	0.19
58_K	66_N	0.690	0.19
11_L	49_T	0.686	0.19
48_D	83_E	0.682	0.19
3_D	34_Y	0.679	0.19
11_L	37_E	0.679	0.19
79_T	83_E	0.676	0.19
53_K	88_Y	0.673	0.19
61_I	75_R	0.667	0.18
47_L	65_T	0.665	0.18
39_H	62_D	0.656	0.18
20_E	30_L	0.654	0.18
41_G	65_T	0.653	0.18
9_R	15_I	0.647	0.18
78_L	86_H	0.642	0.18
17_G	84_W	0.638	0.18
54_G	70_L	0.636	0.17
40_H	62_D	0.635	0.17
17_G	88_Y	0.630	0.17
18_L	21_P	0.619	0.17
42_R	55_L	0.615	0.17
29_E	53_K	0.613	0.17
13_Y	85_E	0.600	0.16
10_D	13_Y	0.595	0.16
51_V	65_T	0.587	0.16
20_E	24_L	0.586	0.16
41_G	66_N	0.583	0.16
54_G	80_A	0.581	0.16
14_A	71_T	0.580	0.16
23_G	64_R	0.569	0.16
28_D	76_R	0.564	0.15
26_V	47_L	0.562	0.15
48_D	60_E	0.556	0.15
30_L	71_T	0.553	0.15
40_H	55_L	0.551	0.15
20_E	67_S	0.550	0.15
37_E	73_R	0.547	0.15
9_R	12_L	0.538	0.15
24_L	62_D	0.537	0.15
60_E	63_Q	0.534	0.15
41_G	51_V	0.533	0.15
5_T	46_N	0.533	0.15
3_D	85_E	0.533	0.15
13_Y	17_G	0.531	0.14
33_Y	71_T	0.527	0.14
51_V	58_K	0.514	0.14
51_V	81_R	0.512	0.14
17_G	33_Y	0.503	0.14
32_N	35_E	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2co5A	2	0.9785	98.8	0.742	Contact Map
3l9fA	2	0.9032	98.6	0.756	Contact Map
1yg2A	2	0.8495	98.4	0.77	Contact Map
3elkA	3	0.9677	98.3	0.777	Contact Map
2e1nA	2	0.957	98.3	0.779	Contact Map
3f8bA	2	0.9462	98.3	0.779	Contact Map
1xmaA	2	0.9247	98.3	0.779	Contact Map
2zfwA	2	0.9247	98.3	0.78	Contact Map
2eshA	2	0.9785	98.2	0.782	Contact Map
2dqlA	2	0.9785	98.1	0.788	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.