TBPC - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TBPC - TATA-box-binding protein C

UniProt:	O52004	Sequences: MTVEIANIVGSGDLGVELDVEPLEADLSTPYSEYDPSNYHGLYVRLEENGPLITVYRSGKYIITGCASMESLHETNEEFLGMLADLGVTEEDTQTGFTVENVVCTAMLDELVSLNALAIGLGLEVTEYEPEQFPGLVYRPEEIGAVLLVFANGKMVITGAKDTETAESAYEYFQSKVQELV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	181 (161)
Sequences:	174 (127)
Seq/√Len:	10.0

HALSA - TBPC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
115_N	155_M	3.016	0.93
151_A	157_I	3.014	0.93
115_N	126_T	2.889	0.91
19_D	23_L	2.524	0.84
22_P	25_A	2.497	0.84
37_S	40_H	2.324	0.79
51_P	54_T	2.267	0.77
115_N	122_G	2.207	0.75
171_E	175_S	2.181	0.74
98_T	151_A	2.181	0.74
106_A	115_N	2.153	0.73
102_V	155_M	2.131	0.72
126_T	155_M	2.114	0.72
19_D	25_A	2.044	0.69
61_Y	64_T	1.992	0.67
151_A	170_Y	1.989	0.67
81_G	86_L	1.987	0.67
106_A	155_M	1.848	0.61
21_E	25_A	1.790	0.58
98_T	170_Y	1.743	0.56
90_E	93_T	1.717	0.55
104_C	151_A	1.715	0.55
98_T	144_G	1.696	0.54
171_E	180_L	1.687	0.53
18_L	22_P	1.647	0.52
32_S	36_P	1.561	0.48
165_T	176_K	1.555	0.47
58_S	62_I	1.546	0.47
27_L	31_Y	1.543	0.47
102_V	115_N	1.529	0.46
96_G	122_G	1.518	0.46
102_V	126_T	1.513	0.46
122_G	155_M	1.511	0.45
144_G	170_Y	1.509	0.45
106_A	126_T	1.503	0.45
48_E	52_L	1.502	0.45
104_C	116_A	1.500	0.45
28_S	33_E	1.480	0.44
20_V	165_T	1.464	0.43
168_S	172_Y	1.458	0.43
154_K	178_Q	1.445	0.42
29_T	34_Y	1.426	0.42
38_N	41_G	1.395	0.40
112_V	117_L	1.365	0.39
90_E	176_K	1.356	0.39
41_G	44_V	1.355	0.38
85_D	88_V	1.352	0.38
93_T	176_K	1.347	0.38
31_Y	34_Y	1.336	0.38
48_E	54_T	1.335	0.38
171_E	178_Q	1.321	0.37
19_D	24_E	1.320	0.37
69_M	72_L	1.306	0.36
71_S	74_E	1.286	0.36
144_G	157_I	1.277	0.35
50_G	58_S	1.263	0.35
35_D	39_Y	1.261	0.34
55_V	60_K	1.250	0.34
29_T	37_S	1.248	0.34
175_S	178_Q	1.244	0.34
29_T	38_N	1.237	0.33
36_P	39_Y	1.203	0.32
32_S	38_N	1.195	0.32
48_E	60_K	1.194	0.32
58_S	67_A	1.180	0.31
20_V	25_A	1.172	0.31
47_E	64_T	1.171	0.31
106_A	122_G	1.168	0.31
137_V	166_A	1.163	0.31
34_Y	38_N	1.157	0.30
148_L	156_V	1.146	0.30
144_G	151_A	1.142	0.30
19_D	22_P	1.129	0.29
19_D	85_D	1.128	0.29
30_P	38_N	1.121	0.29
19_D	26_D	1.120	0.29
102_V	122_G	1.111	0.29
42_L	46_L	1.100	0.28
38_N	68_S	1.094	0.28
59_G	66_C	1.094	0.28
83_L	86_L	1.086	0.28
132_Q	156_V	1.077	0.27
104_C	144_G	1.072	0.27
34_Y	37_S	1.069	0.27
22_P	26_D	1.053	0.26
30_P	37_S	1.049	0.26
111_L	116_A	1.042	0.26
33_E	53_I	1.040	0.26
47_E	51_P	1.036	0.26
18_L	25_A	1.035	0.26
97_F	139_R	1.029	0.26
33_E	43_Y	0.990	0.24
31_Y	36_P	0.980	0.24
129_E	135_G	0.979	0.24
104_C	170_Y	0.971	0.24
26_D	31_Y	0.970	0.24
89_T	111_L	0.970	0.24
55_V	59_G	0.968	0.24
25_A	46_L	0.967	0.23
168_S	178_Q	0.953	0.23
25_A	34_Y	0.952	0.23
26_D	33_E	0.949	0.23
49_N	55_V	0.948	0.23
131_E	139_R	0.948	0.23
49_N	53_I	0.927	0.22
51_P	62_I	0.926	0.22
18_L	96_G	0.918	0.22
69_M	75_T	0.911	0.22
54_T	65_G	0.908	0.22
87_G	144_G	0.908	0.22
132_Q	135_G	0.906	0.22
157_I	170_Y	0.897	0.21
18_L	26_D	0.897	0.21
127_E	158_T	0.878	0.21
175_S	180_L	0.876	0.21
17_E	30_P	0.863	0.20
35_D	40_H	0.860	0.20
51_P	59_G	0.859	0.20
33_E	36_P	0.844	0.20
30_P	60_K	0.839	0.20
112_V	145_A	0.833	0.19
123_L	137_V	0.826	0.19
138_Y	145_A	0.825	0.19
111_L	151_A	0.805	0.19
174_Q	179_E	0.802	0.18
87_G	151_A	0.791	0.18
135_G	139_R	0.791	0.18
49_N	77_E	0.790	0.18
134_P	155_M	0.786	0.18
105_T	156_V	0.781	0.18
68_S	78_E	0.775	0.18
41_G	45_R	0.773	0.18
48_E	71_S	0.772	0.18
162_D	169_A	0.772	0.18
44_V	47_E	0.765	0.17
105_T	142_E	0.758	0.17
38_N	47_E	0.755	0.17
52_L	59_G	0.752	0.17
50_G	67_A	0.752	0.17
147_L	158_T	0.752	0.17
145_A	158_T	0.750	0.17
130_P	139_R	0.744	0.17
170_Y	175_S	0.733	0.17
96_G	111_L	0.733	0.17
98_T	116_A	0.730	0.17
97_F	130_P	0.730	0.17
24_E	27_L	0.723	0.16
104_C	157_I	0.719	0.16
55_V	58_S	0.710	0.16
129_E	137_V	0.707	0.16
150_F	156_V	0.704	0.16
131_E	135_G	0.701	0.16
112_V	160_A	0.699	0.16
54_T	62_I	0.696	0.16
129_E	140_P	0.694	0.16
88_V	144_G	0.692	0.16
132_Q	148_L	0.679	0.15
123_L	135_G	0.679	0.15
68_S	73_H	0.678	0.15
17_E	109_D	0.678	0.15
80_L	83_L	0.674	0.15
53_I	58_S	0.673	0.15
36_P	41_G	0.671	0.15
46_L	51_P	0.668	0.15
46_L	70_E	0.668	0.15
45_R	48_E	0.664	0.15
138_Y	147_L	0.657	0.15
55_V	67_A	0.657	0.15
162_D	171_E	0.656	0.15
129_E	132_Q	0.655	0.15
105_T	148_L	0.654	0.15
68_S	74_E	0.652	0.15
51_P	67_A	0.646	0.15
37_S	41_G	0.644	0.15
105_T	150_F	0.642	0.14
22_P	32_S	0.635	0.14
97_F	133_F	0.634	0.14
18_L	28_S	0.628	0.14
98_T	104_C	0.627	0.14
69_M	73_H	0.627	0.14
121_L	179_E	0.627	0.14
73_H	76_N	0.621	0.14
39_Y	50_G	0.618	0.14
127_E	150_F	0.614	0.14
83_L	87_G	0.613	0.14
62_I	65_G	0.613	0.14
70_E	73_H	0.612	0.14
17_E	33_E	0.611	0.14
162_D	175_S	0.611	0.14
76_N	80_L	0.610	0.14
108_L	126_T	0.609	0.14
18_L	21_E	0.608	0.14
94_Q	110_E	0.607	0.14
62_I	67_A	0.604	0.14
60_K	64_T	0.601	0.14
135_G	156_V	0.599	0.14
130_P	150_F	0.596	0.13
32_S	35_D	0.596	0.13
48_E	68_S	0.595	0.13
145_A	160_A	0.593	0.13
37_S	43_Y	0.591	0.13
26_D	91_E	0.588	0.13
117_L	160_A	0.586	0.13
102_V	161_K	0.585	0.13
146_V	158_T	0.584	0.13
129_E	148_L	0.582	0.13
135_G	150_F	0.580	0.13
60_K	68_S	0.579	0.13
105_T	161_K	0.574	0.13
127_E	146_V	0.572	0.13
31_Y	35_D	0.571	0.13
139_R	150_F	0.569	0.13
57_R	62_I	0.568	0.13
103_V	151_A	0.564	0.13
171_E	174_Q	0.562	0.13
33_E	41_G	0.559	0.13
105_T	127_E	0.556	0.13
50_G	57_R	0.556	0.13
39_Y	47_E	0.553	0.13
117_L	145_A	0.553	0.13
68_S	71_S	0.552	0.13
129_E	144_G	0.552	0.13
20_V	26_D	0.551	0.13
42_L	45_R	0.551	0.13
69_M	76_N	0.550	0.12
51_P	69_M	0.549	0.12
70_E	74_E	0.536	0.12
147_L	160_A	0.536	0.12
107_M	134_P	0.536	0.12
18_L	29_T	0.533	0.12
111_L	122_G	0.530	0.12
54_T	58_S	0.529	0.12
145_A	173_F	0.528	0.12
129_E	139_R	0.525	0.12
36_P	51_P	0.518	0.12
106_A	140_P	0.515	0.12
165_T	177_V	0.512	0.12
17_E	21_E	0.512	0.12
56_Y	77_E	0.511	0.12
42_L	62_I	0.506	0.12
118_A	159_G	0.503	0.12
51_P	61_Y	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3eikA	2	0.4751	100	0.533	Contact Map
1ytbA	1	0.4807	100	0.544	Contact Map
1rm1A	1	0.4807	100	0.552	Contact Map
1aisA	1	0.5028	100	0.558	Contact Map
4b0aA	1	0.6851	100	0.562	Contact Map
1mp9A	2	0.5138	100	0.562	Contact Map
2z8uA	2	0.9724	100	0.579	Contact Map
4febA	3	0.1823	79.8	0.939	Contact Map
2d0bA	1	0.4199	72.7	0.943	Contact Map
4py5A	1	0.3978	53.9	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.