O51971 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O51971 - TbpA

UniProt:	O51971	Sequences: MEDPKDTITIENVVASTAIEQELDLSRVAMDLEGADYDPEQFPGLVYRLDEPSVVALLFGSGKLVITGGKHPVDAEHAVDTIDSRLEDLGLLDGYGDRAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	100 (86)
Sequences:	1021 (631)
Seq/√Len:	68.1

HALSA - O51971 TBPC TBPD TBPE TBPF TBPB Q9HI14
SULSO - TBP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_V	69_G	3.722	1.00
42_F	59_F	3.696	1.00
49_L	52_P	3.114	1.00
15_A	75_A	2.997	1.00
54_V	78_A	2.707	1.00
42_F	57_L	2.253	1.00
23_L	28_V	2.125	1.00
46_V	57_L	2.047	1.00
59_F	67_T	2.025	1.00
57_L	65_V	2.017	1.00
17_T	64_L	1.847	1.00
13_V	75_A	1.825	1.00
35_A	45_L	1.820	1.00
13_V	71_H	1.562	0.99
66_I	75_A	1.559	0.99
33_E	40_E	1.532	0.99
54_V	82_I	1.489	0.99
80_D	84_S	1.481	0.99
44_G	59_F	1.472	0.99
70_K	74_D	1.469	0.99
26_S	30_M	1.457	0.98
80_D	88_D	1.436	0.98
66_I	79_V	1.374	0.98
12_N	67_T	1.367	0.98
27_R	31_D	1.348	0.97
22_E	60_G	1.285	0.97
36_D	48_R	1.284	0.97
31_D	89_L	1.283	0.97
43_P	47_Y	1.276	0.96
18_A	63_K	1.273	0.96
59_F	65_V	1.269	0.96
44_G	48_R	1.214	0.95
56_A	82_I	1.187	0.95
54_V	70_K	1.178	0.95
49_L	82_I	1.172	0.94
13_V	18_A	1.144	0.94
48_R	61_S	1.067	0.91
28_V	36_D	1.065	0.91
11_E	70_K	1.063	0.91
14_V	65_V	1.052	0.90
69_G	78_A	1.026	0.89
72_P	76_E	1.006	0.88
36_D	49_L	1.002	0.88
66_I	69_G	0.997	0.88
44_G	57_L	0.974	0.87
14_V	42_F	0.951	0.85
42_F	46_V	0.950	0.85
21_Q	82_I	0.949	0.85
38_D	41_Q	0.936	0.84
49_L	81_T	0.916	0.83
84_S	87_E	0.912	0.83
85_R	88_D	0.895	0.82
50_D	77_H	0.870	0.80
10_I	91_L	0.864	0.79
28_V	32_L	0.863	0.79
48_R	55_V	0.861	0.79
32_L	85_R	0.823	0.76
51_E	77_H	0.817	0.75
19_I	64_L	0.815	0.75
52_P	74_D	0.814	0.75
49_L	78_A	0.812	0.75
19_I	86_L	0.810	0.75
41_Q	70_K	0.802	0.74
72_P	80_D	0.796	0.73
29_A	35_A	0.794	0.73
84_S	89_L	0.790	0.73
46_V	59_F	0.775	0.71
34_G	64_L	0.773	0.71
38_D	47_Y	0.762	0.70
11_E	45_L	0.759	0.70
53_S	70_K	0.757	0.70
49_L	54_V	0.744	0.68
48_R	57_L	0.737	0.68
74_D	77_H	0.722	0.66
17_T	75_A	0.716	0.65
44_G	61_S	0.714	0.65
47_Y	85_R	0.707	0.64
28_V	45_L	0.706	0.64
59_F	63_K	0.704	0.64
11_E	14_V	0.696	0.63
24_D	27_R	0.696	0.63
8_I	86_L	0.696	0.63
41_Q	45_L	0.683	0.62
15_A	19_I	0.680	0.61
9_T	76_E	0.660	0.59
66_I	91_L	0.656	0.59
13_V	72_P	0.645	0.57
17_T	20_E	0.637	0.56
47_Y	57_L	0.627	0.55
39_P	44_G	0.626	0.55
46_V	63_K	0.626	0.55
37_Y	40_E	0.622	0.55
16_S	19_I	0.610	0.53
24_D	60_G	0.608	0.53
76_E	83_D	0.596	0.52
55_V	61_S	0.590	0.51
56_A	73_V	0.586	0.50
43_P	65_V	0.584	0.50
11_E	15_A	0.581	0.50
22_E	32_L	0.579	0.50
6_D	64_L	0.577	0.49
20_E	71_H	0.574	0.49
77_H	81_T	0.568	0.48
35_A	47_Y	0.567	0.48
54_V	66_I	0.561	0.47
64_L	84_S	0.561	0.47
76_E	80_D	0.559	0.47
11_E	78_A	0.552	0.46
61_S	86_L	0.549	0.46
7_T	31_D	0.543	0.45
43_P	57_L	0.541	0.45
9_T	21_Q	0.540	0.45
42_F	63_K	0.540	0.45
27_R	80_D	0.538	0.45
13_V	81_T	0.532	0.44
9_T	82_I	0.531	0.44
8_I	79_V	0.531	0.44
13_V	50_D	0.528	0.43
10_I	14_V	0.524	0.43
25_L	63_K	0.522	0.43
32_L	41_Q	0.521	0.43
21_Q	83_D	0.519	0.42
13_V	74_D	0.518	0.42
57_L	63_K	0.514	0.42
40_E	60_G	0.511	0.41
26_S	45_L	0.510	0.41
7_T	79_V	0.505	0.41
60_G	74_D	0.505	0.41
42_F	61_S	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2z8uA	2	0.9	99.9	0.125	Contact Map
3eikA	2	0.94	99.9	0.126	Contact Map
1aisA	1	1	99.9	0.128	Contact Map
4b0aA	1	0.92	99.9	0.129	Contact Map
1rm1A	1	0.92	99.9	0.132	Contact Map
1ytbA	1	0.96	99.9	0.139	Contact Map
1mp9A	2	1	99.9	0.148	Contact Map
2d0bA	1	0.83	89.9	0.828	Contact Map
3vn5A	1	0.76	84.5	0.842	Contact Map
4py5A	1	0.81	80.5	0.849	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.