O51962 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O51962 - SojA

UniProt:	O51962	Sequences: MAFGRDLVESTLRLSDGDLYYTRNVCYSNGSKNPYYTRYTEGGSMRIDVGMQKGGVGKTTTSINLAGALADRGHDVLAVDADPQGGLTLKLGHREQYREGEYALYDVLSEMGQLTLDDLDELVVQGAGRVAKIGNNAQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (111)
Sequences:	612 (352)
Seq/√Len:	33.4

ECOLI - BCSQ MIND
BACSU - YLXH SOJ
HALSA - O51962 Q9HHZ7 Q9HHU2 Q9HHL5 O54573 O51969 O51991 Q9HNF1 Q9HQY5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_L	133_I	4.989	1.00
70_A	130_V	3.161	1.00
125_Q	131_A	2.333	0.99
63_I	87_L	2.322	0.99
50_G	135_N	2.153	0.99
62_S	78_A	2.131	0.99
25_V	28_S	2.109	0.99
63_I	90_K	2.096	0.98
103_A	106_D	1.998	0.98
96_Q	101_E	1.987	0.98
81_A	104_L	1.976	0.98
126_G	132_K	1.900	0.97
21_Y	25_V	1.879	0.97
122_L	133_I	1.876	0.97
104_L	133_I	1.851	0.97
47_I	65_L	1.708	0.95
85_G	136_N	1.666	0.94
75_D	81_A	1.651	0.94
49_V	65_L	1.604	0.93
125_Q	129_R	1.602	0.93
56_V	87_L	1.593	0.92
22_T	26_C	1.587	0.92
107_V	122_L	1.548	0.91
21_Y	31_S	1.504	0.90
102_Y	106_D	1.477	0.89
48_D	132_K	1.446	0.88
56_V	85_G	1.431	0.87
23_R	27_Y	1.429	0.87
112_G	119_L	1.399	0.86
67_G	86_G	1.341	0.84
88_T	93_H	1.289	0.81
37_T	68_A	1.287	0.81
100_G	138_Q	1.274	0.81
52_Q	86_G	1.260	0.80
38_R	74_H	1.251	0.79
52_Q	64_N	1.245	0.79
26_C	29_N	1.227	0.78
113_Q	119_L	1.221	0.78
69_L	135_N	1.214	0.77
24_N	28_S	1.194	0.76
57_G	90_K	1.176	0.75
21_Y	28_S	1.157	0.74
46_R	75_D	1.156	0.74
65_L	81_A	1.155	0.74
37_T	42_G	1.142	0.73
65_L	96_Q	1.138	0.72
46_R	123_V	1.138	0.72
113_Q	133_I	1.128	0.72
24_N	30_G	1.121	0.71
85_G	88_T	1.119	0.71
24_N	27_Y	1.116	0.71
25_V	81_A	1.113	0.71
106_D	122_L	1.105	0.70
50_G	59_T	1.099	0.70
65_L	111_M	1.077	0.68
50_G	128_G	1.044	0.66
51_M	84_Q	1.043	0.66
22_T	25_V	1.037	0.65
64_N	68_A	1.031	0.65
40_T	46_R	1.018	0.64
37_T	72_R	1.005	0.63
50_G	91_L	0.997	0.62
94_R	101_E	0.969	0.60
62_S	72_R	0.950	0.58
97_Y	103_A	0.943	0.58
63_I	134_G	0.940	0.57
71_D	126_G	0.939	0.57
23_R	97_Y	0.929	0.57
94_R	121_E	0.928	0.56
28_S	81_A	0.905	0.55
21_Y	75_D	0.880	0.52
47_I	132_K	0.879	0.52
40_T	43_G	0.873	0.52
101_E	138_Q	0.872	0.52
48_D	110_E	0.871	0.52
33_N	119_L	0.863	0.51
37_T	65_L	0.861	0.51
57_G	63_I	0.856	0.50
112_G	122_L	0.825	0.48
40_T	74_H	0.823	0.48
89_L	136_N	0.815	0.47
64_N	90_K	0.814	0.47
25_V	75_D	0.809	0.47
30_G	124_V	0.799	0.46
41_E	57_G	0.796	0.45
111_M	123_V	0.795	0.45
25_V	30_G	0.794	0.45
78_A	106_D	0.791	0.45
26_C	107_V	0.786	0.45
79_V	113_Q	0.781	0.44
78_A	90_K	0.779	0.44
101_E	124_V	0.777	0.44
42_G	124_V	0.772	0.43
64_N	105_Y	0.767	0.43
78_A	87_L	0.766	0.43
60_T	75_D	0.763	0.43
76_V	121_E	0.751	0.42
35_Y	124_V	0.745	0.41
77_L	123_V	0.743	0.41
66_A	90_K	0.742	0.41
60_T	136_N	0.735	0.40
57_G	88_T	0.732	0.40
29_N	113_Q	0.728	0.40
85_G	135_N	0.720	0.39
88_T	136_N	0.719	0.39
104_L	119_L	0.713	0.39
61_T	125_Q	0.708	0.38
83_P	89_L	0.696	0.37
24_N	31_S	0.692	0.37
97_Y	104_L	0.688	0.37
41_E	45_M	0.685	0.36
63_I	105_Y	0.684	0.36
96_Q	120_D	0.682	0.36
109_S	123_V	0.681	0.36
47_I	81_A	0.679	0.36
85_G	89_L	0.679	0.36
106_D	135_N	0.675	0.36
60_T	85_G	0.662	0.35
105_Y	121_E	0.662	0.35
23_R	28_S	0.650	0.34
28_S	31_S	0.645	0.33
34_P	112_G	0.634	0.33
64_N	86_G	0.634	0.33
66_A	78_A	0.628	0.32
52_Q	95_E	0.622	0.32
110_E	128_G	0.614	0.31
86_G	127_A	0.611	0.31
56_V	90_K	0.611	0.31
49_V	63_I	0.611	0.31
65_L	108_L	0.610	0.31
63_I	91_L	0.606	0.31
35_Y	109_S	0.603	0.30
45_M	64_N	0.602	0.30
32_K	135_N	0.600	0.30
44_S	109_S	0.590	0.29
81_A	109_S	0.589	0.29
76_V	92_G	0.589	0.29
40_T	138_Q	0.587	0.29
50_G	79_V	0.578	0.29
107_V	113_Q	0.577	0.29
74_H	88_T	0.575	0.28
80_D	84_Q	0.569	0.28
27_Y	31_S	0.568	0.28
38_R	88_T	0.560	0.27
45_M	56_V	0.560	0.27
86_G	95_E	0.556	0.27
27_Y	40_T	0.555	0.27
64_N	67_G	0.549	0.27
70_A	105_Y	0.547	0.27
83_P	107_V	0.547	0.27
62_S	120_D	0.543	0.26
24_N	62_S	0.541	0.26
48_D	101_E	0.531	0.26
119_L	131_A	0.531	0.26
22_T	128_G	0.530	0.25
78_A	83_P	0.529	0.25
123_V	131_A	0.529	0.25
49_V	57_G	0.528	0.25
71_D	113_Q	0.527	0.25
24_N	104_L	0.523	0.25
38_R	71_D	0.522	0.25
76_V	135_N	0.519	0.25
112_G	126_G	0.516	0.25
94_R	108_L	0.512	0.24
27_Y	37_T	0.511	0.24
50_G	87_L	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ez2A	2	0.9928	99.9	0.464	Contact Map
3ez9A	2	0.8705	99.9	0.466	Contact Map
4pfsA	1	0.6475	99.9	0.5	Contact Map
3pg5A	2	0.6835	99.9	0.519	Contact Map
2ynmA	2	0.6475	99.9	0.537	Contact Map
1wcv1	2	0.6115	99.9	0.541	Contact Map
3fwyA	2	0.6547	99.9	0.543	Contact Map
4rz3A	2	0.6259	99.9	0.544	Contact Map
3kjhA	2	0.6331	99.9	0.555	Contact Map
4wzaE	2	0.6547	99.9	0.555	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.