O51961 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O51961 - Uncharacterized protein

UniProt:	O51961	Sequences: MENELKVYRAKHDLTQEDLAKEVGVTRQTINALEAERYDPSLELAFKLAIYFDCSIEDIFSYDSD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	65 (59)
Sequences:	1900 (1192)
Seq/√Len:	155.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_E	21_K	2.831	1.00
22_E	51_Y	2.653	1.00
4_E	7_V	2.390	1.00
46_F	56_I	2.287	1.00
55_S	58_D	2.208	1.00
9_R	34_E	2.003	1.00
14_L	51_Y	1.991	1.00
7_V	10_A	1.702	1.00
8_Y	59_I	1.697	1.00
8_Y	54_C	1.657	1.00
18_D	22_E	1.655	1.00
54_C	58_D	1.603	1.00
6_K	10_A	1.587	1.00
15_T	18_D	1.464	1.00
23_V	51_Y	1.458	1.00
7_V	13_D	1.412	1.00
7_V	11_K	1.374	1.00
43_E	47_K	1.373	1.00
25_V	30_I	1.307	1.00
48_L	59_I	1.291	1.00
31_N	35_A	1.284	1.00
12_H	53_D	1.278	1.00
29_T	38_Y	1.231	1.00
49_A	56_I	1.230	1.00
45_A	56_I	1.207	1.00
8_Y	11_K	1.196	1.00
4_E	61_S	1.196	1.00
19_L	30_I	1.179	1.00
33_L	38_Y	1.150	1.00
18_D	21_K	1.054	0.99
10_A	13_D	1.027	0.99
14_L	18_D	1.021	0.99
39_D	42_L	0.999	0.99
39_D	43_E	0.989	0.99
23_V	52_F	0.985	0.99
4_E	8_Y	0.930	0.98
28_Q	32_A	0.922	0.98
27_R	60_F	0.897	0.98
12_H	22_E	0.888	0.98
54_C	59_I	0.876	0.97
16_Q	30_I	0.863	0.97
26_T	32_A	0.863	0.97
14_L	22_E	0.844	0.97
6_K	13_D	0.821	0.96
47_K	50_I	0.820	0.96
19_L	52_F	0.818	0.96
23_V	30_I	0.791	0.95
5_L	61_S	0.782	0.95
15_T	31_N	0.772	0.95
38_Y	44_L	0.739	0.93
11_K	54_C	0.726	0.93
25_V	33_L	0.722	0.92
4_E	11_K	0.716	0.92
3_N	26_T	0.715	0.92
37_R	42_L	0.691	0.91
5_L	48_L	0.682	0.90
16_Q	27_R	0.679	0.90
19_L	23_V	0.653	0.88
48_L	54_C	0.646	0.87
8_Y	12_H	0.642	0.87
3_N	45_A	0.638	0.87
41_S	44_L	0.637	0.87
25_V	29_T	0.619	0.85
46_F	50_I	0.613	0.85
23_V	44_L	0.610	0.84
17_E	27_R	0.605	0.84
3_N	60_F	0.589	0.82
56_I	61_S	0.580	0.81
46_F	61_S	0.578	0.81
24_G	36_E	0.572	0.80
4_E	55_S	0.571	0.80
6_K	36_E	0.560	0.79
26_T	40_P	0.557	0.79
32_A	37_R	0.546	0.77
55_S	61_S	0.538	0.76
5_L	19_L	0.532	0.75
15_T	35_A	0.529	0.75
3_N	28_Q	0.526	0.75
33_L	42_L	0.525	0.74
6_K	35_A	0.523	0.74
44_L	47_K	0.521	0.74
27_R	37_R	0.517	0.73
40_P	44_L	0.514	0.73
46_F	57_E	0.513	0.73
4_E	54_C	0.512	0.73
38_Y	41_S	0.509	0.72
33_L	44_L	0.503	0.71
4_E	22_E	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y9qA	1	1	99.5	0.24	Contact Map
3u3wA	2	0.9846	99.5	0.243	Contact Map
2p5tA	2	0.0462	99.5	0.245	Contact Map
4yarA	2	1	99.5	0.25	Contact Map
4o8bA	2	1	99.5	0.253	Contact Map
4ichA	2	0	99.5	0.26	Contact Map
3tysA	2	0.9846	99.5	0.262	Contact Map
3mlfA	2	1	99.5	0.263	Contact Map
3ivpA	2	1	99.5	0.264	Contact Map
4ndwA	2	1	99.5	0.266	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.