O51955 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

O51955 - Uncharacterized protein

UniProt:	O51955	Sequences: MTESTPPLHPMEREQLRAESTLVVTVTPSSEFHDDITDSIAALEQGDAMDSTPTLSFTSYDDLMDTLTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRKRPVVWFDELVINLPFDPEAGDTAAAAP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (116)
Sequences:	225 (162)
Seq/√Len:	15.0

HALSA - O51955 Q9HSX1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_V	103_E	4.837	1.00
70_R	73_E	4.269	1.00
74_L	89_T	2.554	0.94
87_N	96_D	2.415	0.92
39_S	43_L	2.315	0.91
68_T	71_V	2.167	0.88
71_V	127_W	1.932	0.81
41_A	44_E	1.923	0.80
97_V	101_H	1.869	0.78
103_E	106_R	1.836	0.77
42_A	47_D	1.806	0.76
91_R	97_V	1.751	0.73
59_S	76_E	1.747	0.73
80_Q	126_V	1.735	0.73
78_I	113_I	1.708	0.71
104_L	113_I	1.600	0.66
38_D	41_A	1.594	0.66
47_D	61_D	1.555	0.64
87_N	91_R	1.538	0.63
89_T	112_I	1.506	0.61
104_L	121_R	1.495	0.61
36_I	39_S	1.469	0.59
88_E	93_V	1.451	0.58
97_V	128_F	1.439	0.58
32_F	36_I	1.436	0.58
39_S	66_T	1.411	0.56
103_E	127_W	1.409	0.56
100_V	107_L	1.402	0.56
84_A	108_A	1.388	0.55
31_E	113_I	1.370	0.54
64_M	133_I	1.368	0.54
46_G	75_I	1.343	0.52
96_D	119_G	1.342	0.52
74_L	78_I	1.303	0.50
70_R	98_K	1.301	0.50
87_N	97_V	1.276	0.49
22_L	75_I	1.275	0.49
40_I	74_L	1.264	0.48
108_A	121_R	1.262	0.48
78_I	108_A	1.262	0.48
93_V	100_V	1.247	0.47
76_E	94_D	1.243	0.47
88_E	91_R	1.242	0.47
98_K	102_E	1.240	0.47
44_E	112_I	1.218	0.45
74_L	128_F	1.207	0.45
59_S	138_D	1.206	0.45
90_A	100_V	1.188	0.44
114_F	131_L	1.171	0.43
70_R	135_L	1.159	0.42
97_V	112_I	1.150	0.42
51_S	56_S	1.145	0.41
24_V	89_T	1.102	0.39
110_L	126_V	1.078	0.38
81_E	92_V	1.077	0.38
99_N	102_E	1.072	0.37
53_P	58_T	1.066	0.37
94_D	120_Q	1.048	0.36
60_Y	64_M	1.041	0.36
87_N	119_G	1.040	0.36
24_V	112_I	1.022	0.35
68_T	103_E	1.018	0.35
60_Y	72_L	1.012	0.34
40_I	131_L	1.001	0.34
73_E	105_S	1.001	0.34
20_S	53_P	0.993	0.33
83_P	118_D	0.990	0.33
60_Y	133_I	0.963	0.32
71_V	89_T	0.963	0.32
78_I	83_P	0.957	0.32
89_T	93_V	0.957	0.32
82_E	127_W	0.956	0.32
41_A	113_I	0.954	0.31
21_T	119_G	0.922	0.30
55_L	85_S	0.915	0.30
71_V	106_R	0.907	0.29
109_H	114_F	0.906	0.29
63_L	96_D	0.902	0.29
60_Y	137_F	0.897	0.29
110_L	131_L	0.896	0.29
37_T	47_D	0.884	0.28
25_T	56_S	0.875	0.28
21_T	59_S	0.873	0.28
27_T	58_T	0.855	0.27
80_Q	135_L	0.844	0.26
57_F	127_W	0.843	0.26
99_N	103_E	0.841	0.26
88_E	92_V	0.835	0.26
27_T	31_E	0.825	0.26
79_R	99_N	0.813	0.25
128_F	132_V	0.808	0.25
80_Q	92_V	0.804	0.25
86_I	112_I	0.802	0.25
35_D	49_M	0.796	0.24
93_V	103_E	0.793	0.24
35_D	75_I	0.789	0.24
78_I	116_E	0.788	0.24
24_V	31_E	0.788	0.24
22_L	55_L	0.787	0.24
47_D	113_I	0.780	0.24
89_T	104_L	0.773	0.23
64_M	89_T	0.763	0.23
43_L	96_D	0.758	0.23
25_T	54_T	0.758	0.23
88_E	125_V	0.754	0.23
60_Y	129_D	0.754	0.23
23_V	118_D	0.751	0.23
78_I	82_E	0.748	0.22
85_S	104_L	0.737	0.22
109_H	113_I	0.737	0.22
89_T	103_E	0.725	0.22
63_L	67_L	0.725	0.22
90_A	119_G	0.700	0.21
28_P	56_S	0.698	0.21
131_L	136_P	0.698	0.21
69_P	136_P	0.696	0.20
40_I	115_F	0.692	0.20
85_S	121_R	0.690	0.20
47_D	75_I	0.689	0.20
57_F	67_L	0.686	0.20
108_A	118_D	0.683	0.20
99_N	106_R	0.682	0.20
59_S	62_D	0.668	0.19
31_E	109_H	0.667	0.19
36_I	63_L	0.665	0.19
59_S	72_L	0.659	0.19
95_R	113_I	0.654	0.19
75_I	120_Q	0.652	0.19
72_L	138_D	0.645	0.19
46_G	55_L	0.642	0.19
105_S	108_A	0.640	0.19
24_V	98_K	0.634	0.18
82_E	121_R	0.632	0.18
68_T	101_H	0.628	0.18
103_E	132_V	0.623	0.18
74_L	137_F	0.619	0.18
51_S	113_I	0.617	0.18
104_L	108_A	0.590	0.17
117_E	127_W	0.589	0.17
96_D	101_H	0.575	0.16
31_E	120_Q	0.573	0.16
71_V	104_L	0.569	0.16
93_V	104_L	0.568	0.16
105_S	139_P	0.568	0.16
28_P	63_L	0.568	0.16
38_D	81_E	0.566	0.16
72_L	116_E	0.562	0.16
88_E	119_G	0.557	0.16
60_Y	75_I	0.555	0.16
28_P	55_L	0.553	0.16
82_E	92_V	0.549	0.16
37_T	59_S	0.548	0.16
22_L	70_R	0.547	0.16
90_A	117_E	0.546	0.16
46_G	113_I	0.542	0.15
49_M	67_L	0.539	0.15
80_Q	84_A	0.537	0.15
39_S	100_V	0.536	0.15
61_D	111_G	0.534	0.15
112_I	127_W	0.534	0.15
34_D	42_A	0.534	0.15
20_S	93_V	0.533	0.15
30_S	39_S	0.532	0.15
81_E	115_F	0.525	0.15
34_D	129_D	0.522	0.15
21_T	118_D	0.519	0.15
64_M	128_F	0.515	0.15
74_L	117_E	0.513	0.15
37_T	61_D	0.511	0.15
111_G	135_L	0.511	0.15
20_S	74_L	0.509	0.14
40_I	44_E	0.508	0.14
33_H	70_R	0.504	0.14
40_I	85_S	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lb6B	2	0.4228	97.3	0.847	Contact Map
1i1gA	5	0.5503	97	0.856	Contact Map
1r1uA	2	0.6242	96.9	0.857	Contact Map
3f6vA	2	0.5436	96.9	0.857	Contact Map
2k4bA	1	0.4362	96.9	0.857	Contact Map
2fu4A	2	0.4698	96.9	0.858	Contact Map
2w25A	6	0.5503	96.8	0.859	Contact Map
1u2wA	2	0.698	96.8	0.859	Contact Map
1p6rA	1	0.5235	96.8	0.86	Contact Map
2oqgA	4	0.6577	96.8	0.86	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.