RL14 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL14 - 50S ribosomal protein L14

UniProt:	O24787	Sequences: MEAIKADITQGLEKGSLITCADNTGARELKITSVMGYQGRKNRHPKAGLGDTITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIIDDLGEPRGTEIKGPISREVAERYGTIASTATMIV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (117)
Sequences:	1540 (553)
Seq/√Len:	51.1

ECOLI - RL14
BACSU - RL14
HALSA - RL14
SULSO - RL14

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_V	69_L	4.832	1.00
29_L	95_A	4.069	1.00
31_I	53_I	3.748	1.00
29_L	55_V	3.154	1.00
17_L	28_E	2.963	1.00
12_L	31_I	2.768	1.00
30_K	58_T	2.706	1.00
71_A	95_A	2.655	1.00
15_G	30_K	2.654	1.00
81_R	87_R	2.369	1.00
35_M	54_T	2.267	1.00
28_E	59_K	2.133	1.00
12_L	16_S	2.098	1.00
97_I	105_R	2.039	1.00
54_T	70_E	2.009	1.00
56_S	66_R	1.926	0.99
13_E	16_S	1.887	0.99
47_A	73_V	1.860	0.99
19_T	92_D	1.833	0.99
29_L	57_V	1.829	0.99
117_V	125_A	1.783	0.99
17_L	30_K	1.762	0.99
99_D	103_E	1.753	0.99
48_G	80_I	1.741	0.99
70_E	100_D	1.737	0.99
20_C	29_L	1.705	0.99
14_K	33_S	1.703	0.99
19_T	28_E	1.625	0.98
48_G	79_P	1.521	0.97
105_R	119_E	1.445	0.96
30_K	56_S	1.410	0.95
82_R	116_E	1.386	0.95
52_T	121_Y	1.361	0.94
52_T	98_I	1.257	0.92
74_V	113_I	1.193	0.89
102_G	121_Y	1.168	0.88
123_T	126_S	1.153	0.88
118_A	122_G	1.150	0.88
113_I	117_V	1.146	0.87
17_L	58_T	1.140	0.87
14_K	30_K	1.131	0.87
38_Q	42_N	1.089	0.85
18_I	29_L	1.088	0.85
94_A	119_E	1.072	0.84
82_R	85_G	1.059	0.83
21_A	112_P	1.042	0.82
34_V	47_A	1.041	0.82
20_C	95_A	1.033	0.81
49_L	80_I	1.031	0.81
53_I	73_V	1.014	0.80
64_M	67_Q	1.013	0.80
71_A	97_I	0.990	0.78
122_G	125_A	0.986	0.78
37_Y	45_P	0.972	0.77
24_T	105_R	0.959	0.76
75_R	111_G	0.959	0.76
33_S	42_N	0.914	0.73
75_R	92_D	0.900	0.71
21_A	74_V	0.899	0.71
52_T	102_G	0.894	0.71
59_K	112_P	0.887	0.70
113_I	124_I	0.878	0.70
24_T	106_G	0.868	0.69
29_L	73_V	0.861	0.68
83_P	119_E	0.857	0.68
28_E	58_T	0.852	0.67
75_R	94_A	0.842	0.66
98_I	102_G	0.840	0.66
32_T	67_Q	0.840	0.66
27_R	61_T	0.837	0.66
18_I	53_I	0.827	0.65
49_L	79_P	0.820	0.64
99_D	105_R	0.802	0.63
114_S	119_E	0.798	0.62
12_L	18_I	0.783	0.61
18_I	95_A	0.782	0.61
38_Q	45_P	0.778	0.60
55_V	97_I	0.767	0.59
33_S	38_Q	0.767	0.59
11_G	108_E	0.765	0.59
17_L	56_S	0.764	0.59
69_L	105_R	0.763	0.59
24_T	33_S	0.759	0.58
125_A	129_T	0.755	0.58
66_R	86_T	0.746	0.57
36_G	115_R	0.746	0.57
63_E	67_Q	0.739	0.56
59_K	65_R	0.738	0.56
55_V	95_A	0.735	0.56
74_V	96_V	0.734	0.56
24_T	61_T	0.732	0.56
82_R	94_A	0.730	0.55
27_R	32_T	0.723	0.55
79_P	89_K	0.720	0.54
76_Q	80_I	0.720	0.54
79_P	87_R	0.707	0.53
99_D	102_G	0.703	0.53
72_V	121_Y	0.695	0.52
34_V	45_P	0.691	0.51
117_V	120_R	0.690	0.51
69_L	97_I	0.682	0.50
85_G	94_A	0.681	0.50
55_V	71_A	0.677	0.50
65_R	112_P	0.677	0.50
21_A	104_P	0.674	0.50
75_R	112_P	0.673	0.49
72_V	110_K	0.665	0.49
116_E	124_I	0.651	0.47
110_K	130_M	0.649	0.47
43_R	109_I	0.648	0.47
113_I	118_A	0.645	0.47
108_E	127_T	0.638	0.46
92_D	112_P	0.638	0.46
66_R	76_Q	0.632	0.45
104_P	127_T	0.631	0.45
33_S	66_R	0.628	0.45
38_Q	46_K	0.625	0.44
72_V	124_I	0.623	0.44
70_E	107_T	0.618	0.44
13_E	45_P	0.617	0.44
115_R	130_M	0.615	0.43
26_A	98_I	0.614	0.43
18_I	31_I	0.613	0.43
66_R	105_R	0.612	0.43
14_K	56_S	0.610	0.43
90_F	112_P	0.607	0.43
46_K	106_G	0.607	0.43
42_N	45_P	0.605	0.42
99_D	123_T	0.594	0.41
26_A	60_G	0.587	0.41
80_I	87_R	0.585	0.40
35_M	70_E	0.583	0.40
43_R	125_A	0.580	0.40
47_A	84_D	0.579	0.40
124_I	127_T	0.578	0.40
21_A	75_R	0.576	0.40
31_I	35_M	0.576	0.40
83_P	86_T	0.573	0.39
38_Q	123_T	0.570	0.39
42_N	109_I	0.569	0.39
29_L	69_L	0.568	0.39
104_P	129_T	0.563	0.38
127_T	130_M	0.561	0.38
15_G	77_R	0.557	0.38
26_A	121_Y	0.555	0.37
20_C	26_A	0.554	0.37
101_L	105_R	0.554	0.37
98_I	101_L	0.550	0.37
19_T	77_R	0.547	0.37
12_L	52_T	0.544	0.36
11_G	76_Q	0.543	0.36
117_V	127_T	0.540	0.36
118_A	131_I	0.537	0.36
57_V	63_E	0.536	0.36
61_T	101_L	0.535	0.36
16_S	78_K	0.534	0.35
115_R	121_Y	0.534	0.35
87_R	109_I	0.534	0.35
108_E	123_T	0.533	0.35
56_S	101_L	0.529	0.35
87_R	114_S	0.528	0.35
58_T	62_P	0.524	0.35
49_L	76_Q	0.523	0.34
24_T	97_I	0.522	0.34
65_R	118_A	0.520	0.34
34_V	43_R	0.518	0.34
16_S	31_I	0.513	0.33
75_R	82_R	0.513	0.33
43_R	46_K	0.512	0.33
90_F	114_S	0.510	0.33
29_L	97_I	0.510	0.33
79_P	84_D	0.509	0.33
24_T	104_P	0.509	0.33
72_V	114_S	0.509	0.33
15_G	59_K	0.500	0.32
31_I	95_A	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vq8K	1	1	100	0.037	Contact Map
3zf7W	1	1	100	0.053	Contact Map
3j21J	1	0.9924	100	0.059	Contact Map
1vx7M	1	1	100	0.071	Contact Map
4ujrI	1	1	100	0.071	Contact Map
3bboM	1	0.8939	100	0.121	Contact Map
1whiA	2	0.8939	100	0.127	Contact Map
4rb6O	1	0.8939	100	0.128	Contact Map
4tp9K	1	0.8864	100	0.141	Contact Map
1vw4I	1	0.8788	100	0.143	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.