RS17 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS17 - 30S ribosomal protein S17P

UniProt:	O24786	Sequences: MAIGLNVTEPEGTCSDEDCPFHGNLSVRGQVLEGEVASTDMEKTVVVEREYDVFVPKYDRYMKRRSRVPAHAPECFDISVGDTVSIAETRPLSKTKSHVVVEITDGGDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	109 (104)
Sequences:	367 (190)
Seq/√Len:	18.7

HALSA - RS17
SULSO - RS17

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_V	69_P	4.208	1.00
72_A	78_I	3.758	1.00
87_A	101_V	3.594	1.00
44_T	96_K	3.463	1.00
14_C	22_H	3.372	1.00
70_A	86_I	2.703	0.98
47_V	86_I	2.209	0.93
21_F	89_T	2.049	0.90
45_V	72_A	2.035	0.90
3_I	101_V	1.962	0.88
68_V	86_I	1.804	0.83
48_E	67_R	1.742	0.81
54_F	59_D	1.736	0.81
8_T	31_V	1.696	0.79
38_S	88_E	1.686	0.79
22_H	75_C	1.675	0.79
88_E	97_S	1.638	0.77
37_A	45_V	1.576	0.74
8_T	11_E	1.491	0.70
45_V	100_V	1.423	0.66
50_E	65_R	1.422	0.66
14_C	75_C	1.406	0.65
19_C	22_H	1.404	0.65
33_E	104_T	1.382	0.64
7_V	25_L	1.365	0.63
85_S	104_T	1.297	0.59
3_I	23_G	1.278	0.57
47_V	83_T	1.271	0.57
6_N	30_Q	1.243	0.55
60_R	81_G	1.239	0.55
18_D	92_L	1.227	0.54
59_D	63_K	1.216	0.54
40_D	44_T	1.213	0.53
59_D	102_E	1.177	0.51
47_V	89_T	1.176	0.51
68_V	80_V	1.167	0.51
36_V	72_A	1.162	0.50
10_P	19_C	1.156	0.50
25_L	32_L	1.133	0.48
36_V	45_V	1.120	0.48
39_T	70_A	1.091	0.46
96_K	101_V	1.072	0.45
35_E	50_E	1.047	0.43
14_C	19_C	1.025	0.42
60_R	64_R	0.990	0.40
8_T	24_N	0.989	0.40
67_R	87_A	0.989	0.40
27_V	99_V	0.988	0.40
18_D	25_L	0.982	0.39
6_N	63_K	0.974	0.39
32_L	92_L	0.968	0.38
34_G	71_H	0.967	0.38
14_C	76_F	0.966	0.38
78_I	96_K	0.966	0.38
48_E	65_R	0.962	0.38
35_E	42_E	0.961	0.38
33_E	83_T	0.957	0.38
85_S	102_E	0.939	0.37
7_V	14_C	0.932	0.36
46_V	100_V	0.929	0.36
41_M	63_K	0.918	0.35
5_L	103_I	0.916	0.35
39_T	80_V	0.912	0.35
19_C	75_C	0.908	0.35
25_L	92_L	0.908	0.35
33_E	37_A	0.907	0.35
39_T	72_A	0.904	0.35
45_V	70_A	0.904	0.35
6_N	87_A	0.902	0.35
15_S	40_D	0.877	0.33
66_S	83_T	0.865	0.32
48_E	60_R	0.861	0.32
93_S	96_K	0.859	0.32
18_D	71_H	0.853	0.32
10_P	22_H	0.848	0.32
4_G	20_P	0.847	0.31
16_D	79_S	0.837	0.31
54_F	61_Y	0.825	0.30
18_D	24_N	0.820	0.30
23_G	93_S	0.804	0.29
53_V	62_M	0.802	0.29
11_E	46_V	0.795	0.29
15_S	22_H	0.791	0.29
63_K	91_P	0.786	0.28
32_L	86_I	0.782	0.28
69_P	93_S	0.771	0.28
49_R	89_T	0.765	0.27
60_R	71_H	0.761	0.27
65_R	87_A	0.752	0.27
57_K	84_V	0.750	0.26
35_E	83_T	0.746	0.26
25_L	73_P	0.740	0.26
60_R	93_S	0.736	0.26
47_V	68_V	0.735	0.26
66_S	86_I	0.724	0.25
28_R	34_G	0.724	0.25
49_R	60_R	0.714	0.25
32_L	51_Y	0.701	0.24
3_I	6_N	0.696	0.24
37_A	68_V	0.691	0.24
33_E	79_S	0.690	0.24
61_Y	85_S	0.690	0.24
32_L	43_K	0.689	0.24
72_A	96_K	0.685	0.23
46_V	97_S	0.685	0.23
7_V	101_V	0.679	0.23
18_D	21_F	0.678	0.23
16_D	19_C	0.676	0.23
83_T	104_T	0.671	0.23
39_T	45_V	0.667	0.23
26_S	53_V	0.666	0.23
64_R	80_V	0.664	0.22
13_T	76_F	0.659	0.22
42_E	66_S	0.643	0.22
55_V	62_M	0.631	0.21
47_V	55_V	0.628	0.21
26_S	30_Q	0.625	0.21
33_E	80_V	0.625	0.21
2_A	35_E	0.622	0.21
5_L	101_V	0.612	0.20
10_P	75_C	0.604	0.20
24_N	83_T	0.600	0.20
5_L	38_S	0.594	0.20
4_G	49_R	0.593	0.20
12_G	18_D	0.592	0.20
5_L	87_A	0.587	0.19
21_F	49_R	0.587	0.19
11_E	95_T	0.586	0.19
30_Q	63_K	0.583	0.19
71_H	74_E	0.580	0.19
21_F	30_Q	0.570	0.19
32_L	65_R	0.566	0.19
6_N	89_T	0.565	0.18
17_E	40_D	0.565	0.18
43_K	74_E	0.565	0.18
2_A	72_A	0.564	0.18
90_R	94_K	0.558	0.18
6_N	55_V	0.558	0.18
31_V	41_M	0.549	0.18
10_P	49_R	0.548	0.18
74_E	91_P	0.538	0.17
69_P	77_D	0.537	0.17
49_R	63_K	0.536	0.17
33_E	85_S	0.536	0.17
89_T	98_H	0.530	0.17
71_H	81_G	0.520	0.17
37_A	80_V	0.518	0.17
67_R	79_S	0.517	0.17
89_T	99_V	0.516	0.17
31_V	87_A	0.514	0.17
7_V	83_T	0.512	0.17
9_E	21_F	0.511	0.17
86_I	98_H	0.505	0.16
28_R	94_K	0.503	0.16
32_L	68_V	0.501	0.16
62_M	90_R	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j20R	1	1	100	0.244	Contact Map
4w23L	1	1	100	0.25	Contact Map
3zeyE	1	1	100	0.252	Contact Map
3j60L	1	0.7431	100	0.256	Contact Map
3j7aV	1	1	100	0.258	Contact Map
4bpeQ	1	1	100	0.261	Contact Map
4ujpM	1	1	100	0.261	Contact Map
3bbnQ	1	0.7248	100	0.376	Contact Map
1qd7I	1	0.7431	99.9	0.517	Contact Map
4rb5Q	1	0.7431	99.9	0.518	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.