YKGN - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YKGN - Putative transposase YkgN

UniProt:	Q79E92	Sequences: MSGKRYPEEFKTEAVKQVVDLGYSVASVATRLDITTHSLYAWIKKYGPDSSTNKEQSDAQAEIRRLQKELKRVTDERDILKKAAVDSICQCNTPFNYLFRCFELQCLSRSVV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14418
Length:	112 (89)
Sequences:	1601 (1114)
Seq/√Len:	118.1

ECOLI - YKGN INSN1 INSN2 INSJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
69_E	74_T	5.384	1.00
62_E	67_Q	4.976	1.00
70_L	73_V	4.954	1.00
62_E	65_R	2.625	1.00
59_A	63_I	2.383	1.00
14_A	32_L	2.244	1.00
14_A	39_L	2.060	1.00
8_E	12_T	1.961	1.00
73_V	77_R	1.802	1.00
37_H	40_Y	1.774	1.00
16_K	20_D	1.759	1.00
41_A	45_K	1.747	1.00
26_A	30_T	1.733	1.00
27_S	31_R	1.604	1.00
23_Y	28_V	1.522	1.00
25_V	40_Y	1.512	1.00
70_L	74_T	1.452	1.00
84_A	88_I	1.435	1.00
63_I	67_Q	1.336	1.00
58_D	61_A	1.329	1.00
43_I	47_G	1.280	1.00
69_E	72_R	1.276	1.00
15_V	43_I	1.234	0.99
23_Y	27_S	1.233	0.99
38_S	41_A	1.231	0.99
63_I	66_L	1.219	0.99
19_V	47_G	1.207	0.99
65_R	69_E	1.193	0.99
17_Q	28_V	1.180	0.99
40_Y	44_K	1.163	0.99
83_A	87_S	1.155	0.99
23_Y	31_R	1.155	0.99
18_V	43_I	1.150	0.99
71_K	78_D	1.135	0.99
25_V	43_I	1.094	0.98
19_V	43_I	1.093	0.98
24_S	27_S	1.078	0.98
19_V	46_Y	1.061	0.98
63_I	70_L	1.059	0.98
28_V	31_R	1.057	0.98
61_A	65_R	1.057	0.98
13_E	16_K	1.049	0.98
51_S	56_Q	1.036	0.98
6_Y	11_K	1.024	0.98
55_E	60_Q	1.013	0.97
86_D	90_Q	0.989	0.97
18_V	29_A	0.987	0.97
18_V	28_V	0.980	0.97
35_T	38_S	0.966	0.97
83_A	88_I	0.953	0.96
61_A	64_R	0.948	0.96
71_K	75_D	0.921	0.96
50_S	53_N	0.919	0.95
84_A	87_S	0.907	0.95
79_I	83_A	0.898	0.95
7_P	13_E	0.893	0.95
85_V	88_I	0.883	0.94
81_K	90_Q	0.875	0.94
82_K	85_V	0.869	0.94
71_K	74_T	0.859	0.94
66_L	70_L	0.857	0.93
12_T	16_K	0.814	0.92
6_Y	10_F	0.790	0.90
49_D	54_K	0.781	0.90
43_I	46_Y	0.776	0.90
18_V	25_V	0.773	0.89
17_Q	32_L	0.763	0.89
28_V	45_K	0.754	0.88
51_S	54_K	0.751	0.88
55_E	64_R	0.744	0.87
85_V	89_C	0.740	0.87
41_A	44_K	0.739	0.87
64_R	67_Q	0.718	0.86
45_K	57_S	0.714	0.85
50_S	54_K	0.710	0.85
72_R	75_D	0.709	0.85
57_S	60_Q	0.701	0.84
10_F	76_E	0.700	0.84
11_K	38_S	0.696	0.84
58_D	63_I	0.694	0.84
12_T	46_Y	0.691	0.83
17_Q	31_R	0.690	0.83
83_A	90_Q	0.684	0.83
72_R	76_E	0.683	0.83
55_E	59_A	0.680	0.82
76_E	80_L	0.672	0.82
9_E	13_E	0.667	0.81
26_A	40_Y	0.661	0.81
21_L	28_V	0.655	0.80
11_K	15_V	0.650	0.79
75_D	82_K	0.648	0.79
81_K	86_D	0.639	0.78
10_F	32_L	0.623	0.77
17_Q	21_L	0.622	0.76
83_A	86_D	0.620	0.76
48_P	53_N	0.620	0.76
84_A	91_C	0.618	0.76
74_T	77_R	0.618	0.76
44_K	48_P	0.605	0.74
14_A	17_Q	0.599	0.74
36_T	40_Y	0.591	0.73
70_L	77_R	0.585	0.72
40_Y	47_G	0.584	0.72
56_Q	64_R	0.584	0.72
3_G	37_H	0.576	0.71
24_S	34_I	0.570	0.70
82_K	86_D	0.563	0.69
87_S	90_Q	0.561	0.69
25_V	39_L	0.558	0.68
32_L	39_L	0.554	0.68
78_D	82_K	0.553	0.68
85_V	91_C	0.553	0.68
75_D	85_V	0.551	0.67
60_Q	63_I	0.544	0.66
54_K	64_R	0.541	0.66
77_R	91_C	0.537	0.65
15_V	46_Y	0.537	0.65
49_D	57_S	0.537	0.65
13_E	17_Q	0.536	0.65
6_Y	35_T	0.520	0.63
19_V	50_S	0.520	0.63
18_V	22_G	0.518	0.63
56_Q	60_Q	0.517	0.63
56_Q	59_A	0.517	0.63
47_G	53_N	0.515	0.62
38_S	43_I	0.509	0.61
55_E	63_I	0.508	0.61
77_R	80_L	0.508	0.61
6_Y	14_A	0.504	0.61
50_S	56_Q	0.504	0.61
75_D	79_I	0.504	0.61
77_R	84_A	0.502	0.60
61_A	68_K	0.500	0.60
50_S	57_S	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rn7A	1	0.875	99.8	0.379	Contact Map
2jn6A	1	0.8214	99.7	0.458	Contact Map
1hlvA	1	0.9018	99.1	0.614	Contact Map
2elhA	1	0.625	98.8	0.655	Contact Map
2oa4A	1	0.6518	98.8	0.663	Contact Map
2ao9A	7	0.875	98.6	0.68	Contact Map
2gloA	1	0.5	98.5	0.688	Contact Map
1pdnC	1	0.9107	98.5	0.69	Contact Map
2k27A	1	0.9643	98.5	0.69	Contact Map
4dyqA	5	0.8125	98.5	0.691	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.