INSO2 - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

INSO2 - Putative transposase InsO for insertion sequence element IS911B

UniProt:	Q47718	Sequences: MPFYFRKECPLNSGYLRKNRPEKPDGRRAVLRSQVLELHGISHGSAGARSIATMATRRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNYLERQFAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALEMAWETRGKPVGVMFQAIKAVIIRAGSSGSYCGDTGSGRV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG40121
Length:	198 (189)
Sequences:	5989 (4389)
Seq/√Len:	319.3

ECOLI - INSO2 INSO1 INSK INSF1 INSF2 INSF3 INSF4 INSF5 INSD1 INSD2 INSD3 INSD4 INSD5 INSD6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_R	74_L	3.536	1.00
159_E	189_Y	3.328	1.00
108_E	111_Q	3.030	1.00
35_V	51_I	2.607	1.00
28_R	66_L	2.590	1.00
34_Q	58_R	2.573	1.00
32_R	73_E	2.428	1.00
119_Y	126_W	2.345	1.00
52_A	56_T	2.335	1.00
144_A	156_K	2.332	1.00
144_A	160_M	2.285	1.00
10_P	13_S	2.272	1.00
48_A	68_G	2.121	1.00
34_Q	37_E	2.045	1.00
106_V	112_V	2.042	1.00
110_N	113_W	2.042	1.00
63_G	66_L	2.039	1.00
46_A	50_S	2.007	1.00
38_L	54_M	1.968	1.00
113_W	161_A	1.919	1.00
114_C	135_L	1.910	1.00
142_G	157_A	1.910	1.00
110_N	165_R	1.853	1.00
32_R	70_L	1.851	1.00
115_G	173_F	1.839	1.00
115_G	175_A	1.834	1.00
39_H	76_L	1.813	1.00
38_L	51_I	1.796	1.00
34_Q	60_Y	1.779	1.00
107_T	111_Q	1.768	1.00
54_M	57_R	1.761	1.00
31_L	62_M	1.748	1.00
48_A	64_R	1.746	1.00
162_W	193_T	1.716	1.00
100_L	112_V	1.666	1.00
62_M	67_A	1.661	1.00
189_Y	193_T	1.608	1.00
122_T	125_R	1.542	1.00
130_A	181_I	1.517	1.00
130_A	157_A	1.512	1.00
129_L	143_W	1.510	1.00
121_W	126_W	1.505	1.00
113_W	171_V	1.504	1.00
112_V	135_L	1.501	1.00
151_S	183_A	1.497	1.00
155_M	189_Y	1.491	1.00
151_S	155_M	1.478	1.00
133_L	140_P	1.476	1.00
28_R	69_R	1.474	1.00
16_L	20_R	1.438	1.00
171_V	195_S	1.426	1.00
117_V	180_I	1.406	1.00
54_M	58_R	1.381	1.00
149_P	179_V	1.366	1.00
70_L	74_L	1.347	1.00
66_L	69_R	1.327	1.00
120_I	129_L	1.325	1.00
36_L	40_G	1.324	1.00
113_W	132_V	1.323	1.00
36_L	74_L	1.319	1.00
27_R	66_L	1.318	1.00
149_P	180_I	1.272	1.00
39_H	44_G	1.270	1.00
52_A	64_R	1.267	1.00
190_C	195_S	1.266	1.00
151_S	185_S	1.265	1.00
146_S	150_D	1.263	1.00
52_A	67_A	1.254	1.00
85_R	88_R	1.253	1.00
173_F	186_S	1.247	1.00
188_S	192_D	1.208	1.00
12_N	15_Y	1.191	1.00
115_G	181_I	1.150	1.00
108_E	136_F	1.144	1.00
30_V	34_Q	1.140	1.00
173_F	195_S	1.134	1.00
49_R	68_G	1.134	1.00
68_G	72_K	1.133	1.00
30_V	60_Y	1.130	1.00
184_G	188_S	1.127	1.00
146_S	153_L	1.125	1.00
187_G	191_G	1.118	1.00
37_E	41_I	1.118	1.00
34_Q	38_L	1.105	1.00
109_P	136_F	1.105	1.00
162_W	195_S	1.082	1.00
155_M	185_S	1.062	1.00
36_L	76_L	1.058	1.00
122_T	127_A	1.045	1.00
103_Q	112_V	1.045	1.00
115_G	130_A	1.043	1.00
106_V	111_Q	1.043	1.00
56_T	61_Q	1.028	1.00
179_V	183_A	1.023	1.00
12_N	16_L	1.021	1.00
46_A	54_M	1.019	1.00
142_G	160_M	1.017	1.00
159_E	163_E	1.013	1.00
155_M	159_E	1.013	1.00
64_R	68_G	1.010	1.00
40_G	44_G	1.007	1.00
130_A	153_L	1.002	1.00
119_Y	128_Y	0.988	1.00
39_H	51_I	0.983	1.00
31_L	34_Q	0.982	1.00
131_V	140_P	0.976	1.00
117_V	149_P	0.975	1.00
139_K	165_R	0.974	1.00
142_G	161_A	0.965	1.00
179_V	182_R	0.956	1.00
132_V	161_A	0.952	1.00
9_C	13_S	0.951	1.00
65_W	68_G	0.944	1.00
32_R	36_L	0.939	1.00
109_P	137_A	0.928	1.00
189_Y	192_D	0.925	1.00
22_E	29_A	0.923	1.00
129_L	145_M	0.920	1.00
133_L	138_R	0.919	1.00
35_V	70_L	0.910	1.00
51_I	71_M	0.899	1.00
144_A	153_L	0.897	1.00
66_L	70_L	0.896	1.00
99_Y	172_M	0.885	1.00
127_A	145_M	0.883	1.00
158_L	173_F	0.881	1.00
100_L	135_L	0.865	1.00
152_R	156_K	0.862	1.00
70_L	73_E	0.861	1.00
144_A	157_A	0.852	1.00
158_L	195_S	0.851	1.00
148_S	153_L	0.844	1.00
53_T	56_T	0.839	1.00
13_S	17_R	0.835	1.00
152_R	185_S	0.834	1.00
90_G	93_H	0.834	1.00
50_S	54_M	0.833	1.00
157_A	161_A	0.832	1.00
71_M	76_L	0.828	1.00
53_T	57_R	0.825	1.00
48_A	52_A	0.821	1.00
27_R	30_V	0.821	1.00
168_P	171_V	0.819	1.00
150_D	153_L	0.807	1.00
33_S	37_E	0.801	1.00
28_R	70_L	0.795	1.00
175_A	186_S	0.794	1.00
38_L	41_I	0.793	1.00
88_R	91_H	0.790	1.00
13_S	16_L	0.783	1.00
65_W	69_R	0.781	1.00
52_A	63_G	0.777	1.00
139_K	164_T	0.775	1.00
86_Y	91_H	0.774	1.00
63_G	69_R	0.770	1.00
39_H	78_S	0.767	0.99
14_G	18_K	0.761	0.99
119_Y	149_P	0.755	0.99
130_A	154_T	0.751	0.99
156_K	159_E	0.750	0.99
91_H	95_A	0.740	0.99
5_F	8_E	0.740	0.99
186_S	190_C	0.739	0.99
77_V	80_Q	0.738	0.99
93_H	182_R	0.736	0.99
117_V	154_T	0.734	0.99
91_H	182_R	0.734	0.99
183_A	186_S	0.729	0.99
69_R	73_E	0.728	0.99
165_R	171_V	0.727	0.99
48_A	71_M	0.725	0.99
100_L	172_M	0.724	0.99
37_E	58_R	0.723	0.99
45_S	50_S	0.720	0.99
163_E	166_G	0.717	0.99
113_W	165_R	0.709	0.99
35_V	74_L	0.707	0.99
38_L	58_R	0.696	0.99
35_V	38_L	0.691	0.99
31_L	60_Y	0.691	0.99
41_I	58_R	0.689	0.99
95_A	182_R	0.686	0.99
186_S	189_Y	0.685	0.99
19_N	22_E	0.684	0.99
26_G	32_R	0.684	0.99
17_R	21_P	0.680	0.99
29_A	33_S	0.678	0.99
35_V	71_M	0.677	0.99
39_H	77_V	0.674	0.99
173_F	190_C	0.674	0.99
158_L	190_C	0.671	0.99
166_G	169_V	0.671	0.99
48_A	67_A	0.663	0.99
88_R	182_R	0.662	0.99
146_S	149_P	0.659	0.98
96_I	99_Y	0.659	0.98
93_H	96_I	0.659	0.98
160_M	164_T	0.654	0.98
132_V	157_A	0.651	0.98
17_R	20_R	0.650	0.98
112_V	172_M	0.647	0.98
103_Q	172_M	0.646	0.98
35_V	67_A	0.644	0.98
185_S	188_S	0.643	0.98
9_C	14_G	0.640	0.98
27_R	31_L	0.639	0.98
32_R	39_H	0.638	0.98
72_K	77_V	0.637	0.98
100_L	104_F	0.635	0.98
180_I	183_A	0.634	0.98
96_I	100_L	0.630	0.98
11_L	15_Y	0.629	0.98
90_G	94_V	0.624	0.98
114_C	174_Q	0.620	0.98
4_Y	14_G	0.615	0.98
162_W	167_K	0.612	0.98
98_N	172_M	0.611	0.98
188_S	191_G	0.609	0.97
23_K	26_G	0.606	0.97
185_S	189_Y	0.605	0.97
4_Y	11_L	0.605	0.97
177_K	182_R	0.605	0.97
86_Y	89_G	0.599	0.97
108_E	169_V	0.598	0.97
106_V	135_L	0.597	0.97
68_G	78_S	0.595	0.97
106_V	136_F	0.594	0.97
120_I	127_A	0.592	0.97
158_L	189_Y	0.588	0.97
111_Q	136_F	0.588	0.97
49_R	64_R	0.587	0.97
30_V	33_S	0.587	0.97
113_W	141_V	0.585	0.97
110_N	171_V	0.584	0.97
137_A	165_R	0.582	0.97
110_N	161_A	0.581	0.97
118_T	174_Q	0.580	0.97
55_A	67_A	0.579	0.97
46_A	51_I	0.578	0.97
125_R	147_F	0.572	0.96
16_L	19_N	0.571	0.96
182_R	186_S	0.570	0.96
23_K	27_R	0.569	0.96
149_P	153_L	0.568	0.96
98_N	177_K	0.564	0.96
117_V	129_L	0.563	0.96
18_K	21_P	0.559	0.96
93_H	177_K	0.553	0.96
33_S	36_L	0.548	0.95
28_R	73_E	0.548	0.95
34_Q	55_A	0.547	0.95
114_C	133_L	0.547	0.95
135_L	141_V	0.546	0.95
96_I	187_G	0.546	0.95
155_M	186_S	0.545	0.95
141_V	165_R	0.544	0.95
62_M	65_W	0.539	0.95
4_Y	9_C	0.539	0.95
162_W	171_V	0.538	0.95
146_S	152_R	0.536	0.95
146_S	156_K	0.535	0.95
115_G	186_S	0.535	0.95
151_S	154_T	0.534	0.95
117_V	153_L	0.532	0.95
141_V	171_V	0.529	0.94
157_A	181_I	0.528	0.94
18_K	22_E	0.528	0.94
158_L	186_S	0.526	0.94
28_R	31_L	0.526	0.94
120_I	126_W	0.526	0.94
55_A	58_R	0.524	0.94
68_G	77_V	0.521	0.94
143_W	160_M	0.520	0.94
184_G	191_G	0.518	0.94
184_G	187_G	0.518	0.94
151_S	184_G	0.516	0.94
118_T	131_V	0.516	0.94
36_L	39_H	0.509	0.93
70_L	76_L	0.509	0.93
28_R	32_R	0.508	0.93
97_P	101_E	0.507	0.93
154_T	186_S	0.507	0.93
149_P	154_T	0.502	0.93
135_L	138_R	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4u7bA	2	0.9596	99.9	0.545	Contact Map
4fcyA	4	0.9293	99.9	0.551	Contact Map
3oymA	3	0.9192	99.8	0.645	Contact Map
1bcoA	1	0.4747	99.8	0.656	Contact Map
1cxqA	2	0.4646	99.7	0.694	Contact Map
4cf8A	2	0.4141	99.7	0.696	Contact Map
4fw1A	2	0.4697	99.6	0.7	Contact Map
2x78A	2	0.4495	99.6	0.708	Contact Map
4fw2A	2	0.4646	99.6	0.711	Contact Map
1ex4A	5	0.4242	99.6	0.713	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.