ARNE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARNE - Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE

UniProt:	Q47377	Sequences: MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14344
Length:	111 (106)
Sequences:	685 (488)
Seq/√Len:	47.4

ECOLI - ARNE ARNF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
99_F	106_I	3.386	1.00
23_A	40_L	3.123	1.00
89_V	94_W	2.998	1.00
78_T	97_V	2.977	1.00
90_S	93_H	2.624	1.00
99_F	102_G	2.622	1.00
24_T	55_L	2.580	1.00
61_V	66_A	2.424	1.00
6_L	61_V	2.293	1.00
23_A	43_A	2.261	1.00
57_V	66_A	2.100	1.00
54_W	67_Y	2.009	0.99
77_V	81_A	1.939	0.99
17_Q	67_Y	1.794	0.99
13_S	70_L	1.712	0.98
9_A	57_V	1.665	0.98
17_Q	21_K	1.644	0.98
72_L	75_V	1.627	0.98
20_Q	43_A	1.571	0.97
12_L	54_W	1.553	0.97
69_M	74_F	1.497	0.96
9_A	13_S	1.474	0.96
94_W	98_A	1.455	0.95
6_L	69_M	1.450	0.95
13_S	50_A	1.441	0.95
9_A	70_L	1.433	0.95
54_W	69_M	1.433	0.95
13_S	51_M	1.393	0.94
13_S	74_F	1.390	0.94
82_V	89_V	1.370	0.93
65_I	93_H	1.356	0.93
47_L	51_M	1.332	0.92
48_G	52_V	1.271	0.91
74_F	107_L	1.266	0.90
15_A	19_C	1.230	0.89
36_I	41_G	1.219	0.89
13_S	16_G	1.214	0.88
20_Q	51_M	1.207	0.88
16_G	63_V	1.201	0.88
20_Q	70_L	1.177	0.87
4_L	79_L	1.173	0.87
79_L	94_W	1.163	0.86
20_Q	80_A	1.143	0.85
92_R	95_C	1.129	0.84
91_P	95_C	1.102	0.83
17_Q	54_W	1.085	0.82
3_W	61_V	1.076	0.81
98_A	102_G	1.076	0.81
78_T	89_V	1.053	0.80
13_S	77_V	1.052	0.80
48_G	51_M	1.044	0.79
104_I	108_G	1.038	0.79
50_A	70_L	1.036	0.79
47_L	50_A	1.035	0.79
53_L	84_L	1.026	0.78
8_F	53_L	1.018	0.78
29_I	48_G	1.013	0.77
21_K	24_T	1.001	0.76
65_I	69_M	0.999	0.76
19_C	42_L	0.994	0.76
17_Q	47_L	0.978	0.75
62_P	81_A	0.970	0.74
93_H	107_L	0.970	0.74
6_L	65_I	0.962	0.74
43_A	93_H	0.944	0.72
45_A	48_G	0.930	0.71
8_F	49_L	0.906	0.69
78_T	81_A	0.905	0.69
10_S	56_L	0.901	0.69
97_V	100_I	0.896	0.68
95_C	105_V	0.890	0.68
40_L	52_V	0.882	0.67
21_K	54_W	0.856	0.65
21_K	67_Y	0.855	0.64
21_K	25_C	0.848	0.64
63_V	85_W	0.838	0.63
16_G	51_M	0.824	0.62
13_S	63_V	0.795	0.59
102_G	105_V	0.794	0.59
37_V	107_L	0.793	0.59
20_Q	47_L	0.793	0.59
42_L	88_P	0.791	0.58
45_A	86_H	0.767	0.56
48_G	53_L	0.763	0.56
18_L	22_Q	0.755	0.55
18_L	80_A	0.753	0.55
56_L	60_N	0.751	0.54
9_A	20_Q	0.749	0.54
54_W	96_G	0.740	0.53
19_C	22_Q	0.737	0.53
23_A	47_L	0.728	0.52
45_A	100_I	0.723	0.52
25_C	52_V	0.721	0.51
82_V	94_W	0.720	0.51
21_K	85_W	0.717	0.51
65_I	81_A	0.709	0.50
46_C	51_M	0.692	0.49
3_W	7_V	0.691	0.48
32_R	60_N	0.691	0.48
100_I	104_I	0.674	0.47
16_G	70_L	0.672	0.47
88_P	93_H	0.655	0.45
6_L	54_W	0.652	0.45
34_K	85_W	0.646	0.44
91_P	98_A	0.646	0.44
16_G	47_L	0.636	0.43
44_L	61_V	0.628	0.42
3_W	10_S	0.623	0.42
92_R	106_I	0.622	0.42
83_K	95_C	0.620	0.41
64_G	74_F	0.620	0.41
13_S	73_N	0.618	0.41
62_P	107_L	0.615	0.41
69_M	93_H	0.614	0.41
49_L	102_G	0.604	0.40
9_A	53_L	0.596	0.39
78_T	93_H	0.592	0.39
33_R	105_V	0.592	0.39
42_L	98_A	0.592	0.39
12_L	17_Q	0.589	0.38
7_V	83_K	0.588	0.38
102_G	106_I	0.586	0.38
20_Q	73_N	0.583	0.38
45_A	95_C	0.581	0.38
35_H	81_A	0.580	0.38
85_W	90_S	0.578	0.37
42_L	72_L	0.575	0.37
5_T	98_A	0.575	0.37
13_S	24_T	0.571	0.37
52_V	91_P	0.566	0.36
23_A	93_H	0.565	0.36
17_Q	60_N	0.565	0.36
11_L	60_N	0.560	0.36
97_V	101_I	0.555	0.35
20_Q	30_N	0.553	0.35
49_L	108_G	0.549	0.35
89_V	102_G	0.548	0.35
35_H	91_P	0.548	0.35
23_A	37_V	0.547	0.35
25_C	66_A	0.545	0.34
6_L	94_W	0.544	0.34
24_T	34_K	0.542	0.34
26_F	45_A	0.534	0.33
11_L	83_K	0.534	0.33
51_M	58_L	0.532	0.33
3_W	72_L	0.530	0.33
16_G	71_S	0.528	0.33
21_K	51_M	0.522	0.32
46_C	49_L	0.521	0.32
20_Q	44_L	0.521	0.32
9_A	77_V	0.520	0.32
69_M	100_I	0.520	0.32
50_A	56_L	0.514	0.32
36_I	108_G	0.507	0.31
9_A	47_L	0.506	0.31
77_V	80_A	0.502	0.31
80_A	83_K	0.502	0.31
16_G	50_A	0.501	0.31
53_L	65_I	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i68A	2	0.6937	99.7	0.473	Contact Map
3b5dA	2	0.9099	99.7	0.474	Contact Map
3ar4A	1	0.8198	3.6	0.937	Contact Map
3ixzA	1	0.7928	3.1	0.94	Contact Map
4p79A	1	0.7568	2.4	0.943	Contact Map
3j01B	1	0.4595	2	0.946	Contact Map
4w6vA	1	0.9099	1.7	0.948	Contact Map
2zxeA	1	0.8198	1.6	0.948	Contact Map
3wdoA	1	0.7658	1.3	0.951	Contact Map
3x29A	1	0.7207	1	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.