DINJ - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DINJ - Antitoxin DinJ

UniProt:	Q47150	Sequences: MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13142
Length:	86 (83)
Sequences:	364 (276)
Seq/√Len:	30.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_A	81_F	3.327	1.00
33_L	37_T	2.870	1.00
23_L	41_V	2.818	1.00
65_S	68_G	2.716	1.00
81_F	85_G	2.706	1.00
40_K	44_E	2.640	1.00
77_A	85_G	2.337	0.99
29_T	47_L	2.047	0.98
15_L	42_A	1.789	0.95
38_L	41_V	1.687	0.93
35_R	39_T	1.684	0.93
64_N	74_A	1.643	0.92
61_S	64_N	1.632	0.91
5_A	13_E	1.628	0.91
82_D	85_G	1.606	0.91
8_R	34_V	1.604	0.91
68_G	71_V	1.537	0.89
11_I	38_L	1.502	0.87
30_I	38_L	1.473	0.86
31_S	35_R	1.468	0.86
29_T	32_D	1.413	0.84
40_K	51_L	1.397	0.83
28_L	36_I	1.284	0.78
3_A	13_E	1.271	0.77
32_D	47_L	1.263	0.76
22_V	26_M	1.242	0.75
6_F	34_V	1.220	0.74
61_S	65_S	1.178	0.71
19_A	32_D	1.134	0.68
17_N	21_D	1.120	0.67
64_N	69_I	1.107	0.66
64_N	68_G	1.088	0.65
15_L	76_D	1.079	0.64
33_L	36_I	1.076	0.64
79_D	82_D	1.072	0.64
20_A	29_T	1.071	0.64
56_Q	60_Q	1.060	0.63
56_Q	66_E	1.029	0.61
72_H	83_K	1.026	0.60
54_P	60_Q	1.019	0.60
59_I	62_I	1.015	0.59
24_A	73_K	0.994	0.58
22_V	42_A	0.986	0.57
67_A	71_V	0.976	0.56
70_D	74_A	0.968	0.56
7_V	32_D	0.941	0.54
6_F	9_A	0.930	0.53
4_N	37_T	0.930	0.53
54_P	58_T	0.925	0.52
21_D	63_K	0.918	0.52
32_D	35_R	0.901	0.50
37_T	41_V	0.898	0.50
29_T	53_E	0.898	0.50
62_I	73_K	0.889	0.50
34_V	38_L	0.884	0.49
37_T	49_F	0.880	0.49
22_V	41_V	0.855	0.47
76_D	81_F	0.839	0.46
23_L	37_T	0.835	0.45
69_I	79_D	0.829	0.45
63_K	67_A	0.821	0.44
19_A	35_R	0.813	0.43
74_A	83_K	0.802	0.43
61_S	71_V	0.799	0.42
77_A	83_K	0.796	0.42
20_A	31_S	0.791	0.42
38_L	42_A	0.788	0.42
19_A	42_A	0.786	0.41
8_R	31_S	0.781	0.41
32_D	39_T	0.774	0.40
33_L	49_F	0.763	0.40
62_I	65_S	0.749	0.39
34_V	52_R	0.746	0.38
65_S	85_G	0.745	0.38
56_Q	70_D	0.737	0.38
67_A	75_K	0.728	0.37
26_M	35_R	0.713	0.36
78_D	81_F	0.704	0.35
16_K	49_F	0.704	0.35
3_A	44_E	0.701	0.35
14_D	73_K	0.701	0.35
25_G	43_R	0.696	0.35
75_K	78_D	0.695	0.35
36_I	78_D	0.693	0.34
11_I	36_I	0.689	0.34
22_V	46_A	0.686	0.34
36_I	51_L	0.674	0.33
68_G	74_A	0.670	0.33
63_K	85_G	0.665	0.32
50_D	77_A	0.661	0.32
25_G	32_D	0.655	0.32
12_D	16_K	0.655	0.32
76_D	83_K	0.642	0.31
31_S	40_K	0.641	0.31
17_N	33_L	0.640	0.31
20_A	55_N	0.638	0.31
50_D	66_E	0.635	0.30
64_N	72_H	0.615	0.29
78_D	82_D	0.613	0.29
47_L	51_L	0.612	0.29
46_A	49_F	0.610	0.29
35_R	47_L	0.606	0.28
4_N	69_I	0.604	0.28
11_I	47_L	0.599	0.28
75_K	80_L	0.594	0.28
9_A	22_V	0.593	0.28
4_N	7_V	0.592	0.28
45_K	56_Q	0.578	0.27
23_L	35_R	0.578	0.27
57_L	79_D	0.570	0.26
9_A	38_L	0.569	0.26
77_A	84_L	0.564	0.26
5_A	40_K	0.563	0.26
59_I	67_A	0.552	0.25
14_D	56_Q	0.547	0.25
36_I	43_R	0.541	0.24
13_E	31_S	0.540	0.24
67_A	77_A	0.533	0.24
17_N	67_A	0.529	0.24
18_Q	31_S	0.524	0.23
31_S	44_E	0.521	0.23
23_L	42_A	0.517	0.23
29_T	40_K	0.510	0.23
59_I	63_K	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q2uA	5	0.9767	100	0.195	Contact Map
4fxeA	4	0.8837	99.8	0.386	Contact Map
1bazA	4	0.5581	91.1	0.839	Contact Map
2k9iA	2	0.5814	87.4	0.85	Contact Map
2gpeA	2	0.5116	83.3	0.858	Contact Map
1p94A	2	0.5349	82.4	0.859	Contact Map
2ay0A	2	0.5349	81.2	0.861	Contact Map
2cpgA	2	0.5233	78	0.865	Contact Map
2mdvA	2	0.4419	77.5	0.866	Contact Map
1nlaA	2	0.5814	75.6	0.868	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.