YGCP - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YGCP - Uncharacterized protein YgcP

UniProt:	Q46906	Sequences: MPLLHLLRQNPVIAAVKDNASLQLAIDSECQFISVLYGNICTISNIVKKIKNAGKYAFIHVDLLEGASNKEVVIQFLKLVTEADGIISTKASMLKAARAEGFFCIHRLFIVDSISFHNIDKQVAQSNPDCIEILPGCMPKVLGWVTEKIRQPLIAGGLVCDEEDARNAINAGVVALSTTNTGVWTLAKKLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13123
Length:	191 (179)
Sequences:	642 (520)
Seq/√Len:	38.9

ECOLI - YGCP
BACSU - GLPP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_I	57_A	4.049	1.00
144_W	160_C	3.934	1.00
162_E	166_R	3.039	1.00
25_A	33_I	3.024	1.00
21_S	181_T	3.006	1.00
67_A	73_V	2.828	1.00
14_A	30_C	2.710	1.00
98_R	129_D	2.677	1.00
33_I	50_I	2.600	1.00
51_K	84_D	2.541	1.00
48_K	52_N	2.523	1.00
94_L	104_C	2.448	1.00
47_V	81_T	2.425	1.00
23_Q	49_K	2.415	1.00
88_S	94_L	2.378	1.00
44_S	80_V	2.336	1.00
140_K	164_D	2.180	0.99
77_L	83_A	1.957	0.99
96_A	99_A	1.949	0.99
24_L	181_T	1.928	0.98
60_H	156_G	1.864	0.98
89_T	156_G	1.849	0.98
18_D	21_S	1.831	0.98
108_L	119_I	1.816	0.98
47_V	57_A	1.796	0.97
122_Q	134_L	1.763	0.97
16_V	50_I	1.763	0.97
76_F	80_V	1.755	0.97
22_L	50_I	1.741	0.97
75_Q	96_A	1.725	0.97
145_V	153_L	1.682	0.96
19_N	37_Y	1.642	0.96
63_L	179_T	1.619	0.95
78_K	102_F	1.617	0.95
43_I	76_F	1.610	0.95
178_T	183_V	1.580	0.95
43_I	81_T	1.569	0.94
146_T	153_L	1.565	0.94
31_Q	56_Y	1.562	0.94
138_M	141_V	1.510	0.93
107_R	132_E	1.479	0.92
154_I	177_S	1.461	0.92
64_L	98_R	1.451	0.92
88_S	93_M	1.443	0.92
120_D	145_V	1.435	0.91
43_I	51_K	1.405	0.90
133_I	145_V	1.389	0.90
79_L	131_I	1.350	0.89
89_T	109_F	1.346	0.88
74_I	100_E	1.340	0.88
64_L	67_A	1.314	0.87
105_I	130_C	1.313	0.87
165_A	183_V	1.298	0.86
17_K	63_L	1.290	0.86
168_A	173_V	1.289	0.86
143_G	147_E	1.285	0.86
35_V	50_I	1.280	0.86
117_H	148_K	1.265	0.85
91_A	170_N	1.260	0.85
60_H	89_T	1.257	0.85
32_F	56_Y	1.243	0.84
107_R	156_G	1.239	0.84
163_E	167_N	1.233	0.83
47_V	84_D	1.226	0.83
15_A	36_L	1.218	0.83
106_H	159_V	1.216	0.83
121_K	174_V	1.215	0.83
35_V	57_A	1.207	0.82
36_L	107_R	1.130	0.78
146_T	174_V	1.102	0.76
37_Y	113_S	1.101	0.76
71_E	134_L	1.092	0.75
61_V	74_I	1.090	0.75
124_A	148_K	1.081	0.74
75_Q	100_E	1.068	0.74
39_N	75_Q	1.065	0.73
46_I	58_F	1.065	0.73
111_V	134_L	1.063	0.73
131_I	151_Q	1.053	0.73
123_V	128_P	1.051	0.72
58_F	85_G	1.051	0.72
110_I	140_K	1.047	0.72
88_S	104_C	1.047	0.72
111_V	167_N	1.034	0.71
97_A	104_C	1.030	0.71
54_G	147_E	0.997	0.68
22_L	26_I	0.976	0.67
32_F	87_I	0.967	0.66
68_S	118_N	0.961	0.65
131_I	149_I	0.954	0.65
14_A	134_L	0.953	0.65
27_D	53_A	0.952	0.65
85_G	107_R	0.942	0.64
124_A	176_L	0.939	0.64
38_G	111_V	0.927	0.63
106_H	152_P	0.925	0.62
60_H	128_P	0.921	0.62
144_W	148_K	0.919	0.62
94_L	126_S	0.913	0.61
27_D	182_G	0.910	0.61
35_V	46_I	0.908	0.61
16_V	46_I	0.899	0.60
20_A	182_G	0.899	0.60
36_L	87_I	0.898	0.60
36_L	62_D	0.896	0.60
19_N	179_T	0.892	0.60
165_A	168_A	0.871	0.58
11_P	46_I	0.868	0.57
142_L	155_A	0.867	0.57
35_V	179_T	0.865	0.57
74_I	102_F	0.857	0.56
84_D	108_L	0.854	0.56
86_I	162_E	0.849	0.56
39_N	72_V	0.839	0.55
11_P	162_E	0.835	0.55
142_L	173_V	0.833	0.54
35_V	69_N	0.832	0.54
68_S	93_M	0.829	0.54
61_V	77_L	0.827	0.54
46_I	179_T	0.827	0.54
87_I	134_L	0.826	0.54
147_E	181_T	0.824	0.54
142_L	168_A	0.823	0.53
118_N	121_K	0.820	0.53
170_N	174_V	0.813	0.53
117_H	120_D	0.812	0.52
86_I	167_N	0.801	0.51
16_V	33_I	0.798	0.51
15_A	177_S	0.794	0.51
18_D	25_A	0.793	0.51
90_K	102_F	0.792	0.51
96_A	118_N	0.789	0.50
74_I	86_I	0.786	0.50
140_K	165_A	0.781	0.50
11_P	59_I	0.781	0.50
161_D	166_R	0.781	0.50
44_S	48_K	0.780	0.50
130_C	133_I	0.779	0.49
49_K	53_A	0.778	0.49
120_D	123_V	0.777	0.49
22_L	114_I	0.777	0.49
119_I	130_C	0.776	0.49
115_S	156_G	0.773	0.49
47_V	108_L	0.766	0.48
28_S	171_A	0.765	0.48
10_N	78_K	0.756	0.47
32_F	59_I	0.755	0.47
127_N	151_Q	0.754	0.47
60_H	107_R	0.752	0.47
152_P	169_I	0.742	0.46
37_Y	179_T	0.734	0.45
136_G	142_L	0.731	0.45
36_L	89_T	0.728	0.45
58_F	183_V	0.727	0.45
78_K	83_A	0.724	0.45
68_S	151_Q	0.722	0.44
67_A	75_Q	0.720	0.44
74_I	78_K	0.717	0.44
35_V	110_I	0.717	0.44
91_A	106_H	0.716	0.44
57_A	84_D	0.707	0.43
38_G	119_I	0.704	0.43
17_K	70_K	0.702	0.43
139_P	153_L	0.698	0.42
14_A	56_Y	0.694	0.42
24_L	82_E	0.683	0.41
15_A	111_V	0.682	0.41
88_S	145_V	0.681	0.41
166_R	170_N	0.679	0.41
71_E	88_S	0.671	0.40
8_R	29_E	0.667	0.40
43_I	58_F	0.666	0.39
58_F	180_N	0.665	0.39
88_S	167_N	0.665	0.39
94_L	128_P	0.664	0.39
17_K	164_D	0.661	0.39
107_R	134_L	0.660	0.39
64_L	110_I	0.659	0.39
22_L	49_K	0.658	0.39
85_G	132_E	0.657	0.39
136_G	173_V	0.656	0.39
40_I	154_I	0.654	0.38
136_G	159_V	0.653	0.38
132_E	156_G	0.650	0.38
58_F	154_I	0.649	0.38
47_V	51_K	0.645	0.38
36_L	134_L	0.645	0.38
16_V	19_N	0.643	0.37
89_T	106_H	0.642	0.37
63_L	134_L	0.642	0.37
116_F	145_V	0.641	0.37
78_K	100_E	0.639	0.37
88_S	129_D	0.634	0.37
90_K	173_V	0.632	0.37
160_C	176_L	0.631	0.36
62_D	136_G	0.627	0.36
15_A	171_A	0.623	0.36
36_L	63_L	0.622	0.36
58_F	103_F	0.621	0.36
40_I	93_M	0.620	0.36
144_W	147_E	0.616	0.35
146_T	163_E	0.616	0.35
95_K	141_V	0.612	0.35
34_S	38_G	0.612	0.35
123_V	149_I	0.612	0.35
141_V	164_D	0.609	0.35
76_F	90_K	0.599	0.34
30_C	39_N	0.598	0.34
155_A	164_D	0.596	0.34
12_V	62_D	0.596	0.34
175_A	183_V	0.595	0.33
61_V	103_F	0.594	0.33
92_S	106_H	0.592	0.33
29_E	126_S	0.590	0.33
33_I	69_N	0.589	0.33
167_N	170_N	0.582	0.32
118_N	122_Q	0.578	0.32
20_A	23_Q	0.575	0.32
27_D	54_G	0.575	0.32
95_K	158_L	0.573	0.32
11_P	18_D	0.573	0.32
73_V	130_C	0.569	0.31
102_F	163_E	0.568	0.31
35_V	101_G	0.568	0.31
19_N	170_N	0.567	0.31
59_I	77_L	0.564	0.31
54_G	170_N	0.564	0.31
28_S	55_K	0.563	0.31
19_N	46_I	0.561	0.31
137_C	158_L	0.558	0.31
38_G	158_L	0.557	0.31
70_K	81_T	0.556	0.30
126_S	159_V	0.556	0.30
28_S	101_G	0.555	0.30
36_L	113_S	0.553	0.30
134_L	139_P	0.551	0.30
9_Q	31_Q	0.551	0.30
49_K	101_G	0.549	0.30
28_S	185_T	0.547	0.30
10_N	115_S	0.546	0.30
51_K	170_N	0.546	0.30
113_S	168_A	0.545	0.30
59_I	146_T	0.543	0.29
138_M	183_V	0.543	0.29
21_S	176_L	0.542	0.29
33_I	63_L	0.541	0.29
17_K	114_I	0.541	0.29
134_L	156_G	0.539	0.29
62_D	165_A	0.535	0.29
10_N	30_C	0.535	0.29
59_I	83_A	0.535	0.29
116_F	160_C	0.532	0.29
75_Q	128_P	0.532	0.29
59_I	159_V	0.524	0.28
71_E	130_C	0.522	0.28
27_D	124_A	0.520	0.28
26_I	55_K	0.520	0.28
7_L	77_L	0.517	0.28
42_T	159_V	0.516	0.27
83_A	173_V	0.514	0.27
123_V	126_S	0.513	0.27
88_S	108_L	0.511	0.27
74_I	84_D	0.511	0.27
12_V	165_A	0.511	0.27
63_L	155_A	0.511	0.27
44_S	150_R	0.507	0.27
78_K	88_S	0.505	0.27
36_L	178_T	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vkfA	1	0.8953	100	0.192	Contact Map
3ktsA	1	0.9686	100	0.36	Contact Map
1wa3A	3	0.9267	98.9	0.832	Contact Map
4adtA	5	0.9319	98.6	0.849	Contact Map
3vcrA	3	0.9267	98.6	0.851	Contact Map
1vhcA	3	0.9267	98.5	0.854	Contact Map
4jejA	2	0.9581	98.4	0.858	Contact Map
3vndA	3	0.9476	98.4	0.858	Contact Map
1rd5A	6	0.9529	98.4	0.859	Contact Map
2yw3A	4	0.9162	98.4	0.859	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.