SSUE - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSUE - FMN reductase (NADPH)

UniProt:	P80644	Sequences: MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVPDLLSLRGNAHA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13708
Length:	191 (171)
Sequences:	6732 (4525)
Seq/√Len:	346.0

ECOLI - SSUE CHRR
BACSU - AZR
HALSA - Q9HPI9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_Y	63_Q	4.146	1.00
4_I	67_A	3.111	1.00
2_R	33_E	3.084	1.00
80_A	120_A	2.824	1.00
81_Y	124_V	2.813	1.00
55_P	59_T	2.589	1.00
62_E	66_Q	2.546	1.00
102_V	130_A	2.436	1.00
26_K	162_D	2.369	1.00
17_S	21_E	2.253	1.00
125_L	130_A	2.247	1.00
147_Y	151_P	2.226	1.00
5_T	20_L	2.193	1.00
103_L	164_A	2.036	1.00
86_K	90_D	2.031	1.00
58_K	62_E	1.943	1.00
7_A	17_S	1.937	1.00
59_T	63_Q	1.836	1.00
16_S	107_T	1.811	1.00
60_F	88_L	1.797	1.00
20_L	73_A	1.771	1.00
120_A	123_P	1.748	1.00
104_P	117_V	1.740	1.00
80_A	124_V	1.722	1.00
106_A	114_L	1.720	1.00
158_Q	162_D	1.718	1.00
2_R	66_Q	1.675	1.00
25_E	151_P	1.629	1.00
3_V	69_G	1.612	1.00
5_T	24_R	1.555	1.00
46_D	49_Y	1.544	1.00
17_S	38_N	1.523	1.00
98_Q	129_K	1.510	1.00
21_E	24_R	1.508	1.00
141_D	144_V	1.501	1.00
155_P	159_T	1.500	1.00
69_G	168_F	1.473	1.00
24_R	36_H	1.464	1.00
7_A	20_L	1.443	1.00
38_N	41_N	1.426	1.00
72_V	102_V	1.414	1.00
135_H	167_T	1.383	1.00
3_V	32_V	1.367	1.00
64_L	92_L	1.350	1.00
23_A	105_L	1.349	1.00
89_L	128_L	1.346	1.00
4_I	37_W	1.335	1.00
56_A	59_T	1.328	1.00
133_I	171_A	1.312	1.00
32_V	169_W	1.307	1.00
157_L	160_R	1.307	1.00
72_V	125_L	1.291	1.00
76_V	116_A	1.275	1.00
74_T	121_L	1.270	1.00
2_R	35_Y	1.269	1.00
77_Y	83_G	1.266	1.00
62_E	65_Q	1.257	1.00
102_V	125_L	1.237	1.00
103_L	168_F	1.228	1.00
23_A	71_I	1.226	1.00
70_L	97_L	1.215	1.00
131_Q	171_A	1.212	1.00
83_G	90_D	1.208	1.00
74_T	106_A	1.197	1.00
60_F	92_L	1.185	1.00
81_Y	120_A	1.184	1.00
16_S	73_A	1.182	1.00
137_V	164_A	1.165	1.00
55_P	58_K	1.136	1.00
43_A	56_A	1.132	1.00
35_Y	67_A	1.129	1.00
64_L	70_L	1.128	1.00
69_G	172_L	1.117	1.00
57_L	91_L	1.106	1.00
6_L	72_V	1.065	1.00
24_R	28_N	1.055	1.00
26_K	158_Q	1.053	1.00
61_T	92_L	1.029	1.00
13_P	18_S	1.023	1.00
169_W	173_H	1.020	1.00
112_A	115_L	1.018	1.00
21_E	36_H	1.017	1.00
162_D	166_E	1.014	1.00
159_T	163_T	1.012	1.00
72_V	85_L	1.005	1.00
22_Y	25_E	0.994	1.00
47_L	50_A	0.993	1.00
23_A	161_L	0.986	1.00
19_L	107_T	0.983	1.00
26_K	165_L	0.981	1.00
27_L	34_V	0.979	1.00
74_T	117_V	0.977	1.00
164_A	168_F	0.976	1.00
5_T	36_H	0.974	1.00
26_K	29_G	0.965	1.00
126_S	132_E	0.961	1.00
48_L	52_F	0.954	1.00
72_V	89_L	0.951	1.00
139_A	157_L	0.929	1.00
7_A	16_S	0.927	1.00
5_T	34_V	0.923	1.00
59_T	62_E	0.919	1.00
159_T	162_D	0.914	1.00
166_E	170_Q	0.908	1.00
61_T	96_A	0.906	1.00
133_I	168_F	0.905	1.00
15_R	142_S	0.898	1.00
168_F	172_L	0.896	1.00
37_W	63_Q	0.895	1.00
83_G	86_K	0.892	1.00
115_L	118_D	0.889	1.00
27_L	165_L	0.885	1.00
71_I	103_L	0.885	1.00
64_L	88_L	0.884	1.00
4_I	63_Q	0.879	1.00
108_G	138_F	0.878	1.00
155_P	158_Q	0.871	1.00
19_L	139_A	0.871	1.00
46_D	50_A	0.869	1.00
81_Y	86_K	0.858	1.00
28_N	31_D	0.857	1.00
41_N	59_T	0.856	1.00
106_A	118_D	0.854	1.00
156_N	159_T	0.849	1.00
12_F	40_Q	0.848	1.00
78_K	93_P	0.846	1.00
3_V	172_L	0.844	1.00
114_L	118_D	0.840	1.00
70_L	100_K	0.840	1.00
109_G	143_Q	0.829	1.00
74_T	82_S	0.824	1.00
63_Q	66_Q	0.822	1.00
37_W	60_F	0.819	1.00
80_A	86_K	0.817	1.00
65_Q	96_A	0.815	1.00
86_K	124_V	0.810	1.00
21_E	25_E	0.804	1.00
24_R	34_V	0.799	1.00
122_K	136_G	0.798	1.00
47_L	52_F	0.798	1.00
99_G	131_Q	0.792	1.00
54_S	91_L	0.791	1.00
89_L	121_L	0.788	1.00
129_K	167_T	0.787	1.00
79_A	127_A	0.785	1.00
25_E	28_N	0.776	1.00
5_T	73_A	0.775	1.00
95_R	98_Q	0.774	1.00
125_L	132_E	0.773	1.00
69_G	101_V	0.772	1.00
39_L	88_L	0.771	1.00
44_P	83_G	0.769	1.00
89_L	124_V	0.768	1.00
131_Q	134_L	0.766	1.00
17_S	36_H	0.760	1.00
70_L	102_V	0.757	1.00
10_P	84_A	0.754	1.00
79_A	116_A	0.746	1.00
122_K	126_S	0.746	1.00
41_N	56_A	0.743	1.00
163_T	167_T	0.741	1.00
104_P	125_L	0.740	1.00
120_A	124_V	0.740	1.00
63_Q	67_A	0.736	0.99
97_L	130_A	0.730	0.99
73_A	105_L	0.726	0.99
31_D	169_W	0.725	0.99
170_Q	174_R	0.723	0.99
18_S	21_E	0.718	0.99
8_G	74_T	0.716	0.99
39_L	84_A	0.716	0.99
10_P	83_G	0.714	0.99
80_A	90_D	0.701	0.99
153_F	156_N	0.687	0.99
72_V	121_L	0.676	0.99
142_S	146_D	0.673	0.99
27_L	169_W	0.673	0.99
89_L	125_L	0.672	0.99
81_Y	121_L	0.671	0.99
154_T	157_L	0.667	0.99
25_E	29_G	0.667	0.99
7_A	36_H	0.666	0.99
70_L	130_A	0.656	0.99
18_S	146_D	0.655	0.99
112_A	116_A	0.654	0.99
23_A	165_L	0.647	0.99
71_I	105_L	0.645	0.99
44_P	87_T	0.644	0.99
133_I	167_T	0.642	0.99
87_T	91_L	0.642	0.99
145_I	154_T	0.638	0.99
165_L	169_W	0.638	0.99
146_D	152_Q	0.636	0.99
76_V	113_H	0.633	0.98
3_V	27_L	0.633	0.98
102_V	132_E	0.631	0.98
99_G	129_K	0.630	0.98
19_L	105_L	0.629	0.98
139_A	145_I	0.622	0.98
145_I	157_L	0.617	0.98
92_L	97_L	0.617	0.98
75_P	82_S	0.616	0.98
23_A	73_A	0.614	0.98
127_A	134_L	0.614	0.98
61_T	65_Q	0.612	0.98
35_Y	66_Q	0.604	0.98
106_A	117_V	0.603	0.98
22_Y	158_Q	0.600	0.98
88_L	92_L	0.599	0.98
4_I	70_L	0.593	0.98
5_T	71_I	0.589	0.98
14_S	17_S	0.587	0.98
166_E	169_W	0.586	0.98
143_Q	154_T	0.585	0.97
111_V	141_D	0.584	0.97
76_V	79_A	0.581	0.97
145_I	152_Q	0.581	0.97
55_P	62_E	0.579	0.97
145_I	153_F	0.577	0.97
54_S	57_L	0.577	0.97
7_A	39_L	0.574	0.97
94_E	98_Q	0.568	0.97
79_A	115_L	0.568	0.97
103_L	133_I	0.562	0.97
29_G	162_D	0.559	0.97
48_L	87_T	0.558	0.97
58_K	61_T	0.556	0.97
15_R	18_S	0.553	0.96
20_L	34_V	0.552	0.96
19_L	142_S	0.547	0.96
84_A	88_L	0.540	0.96
31_D	166_E	0.538	0.96
64_L	96_A	0.537	0.96
14_S	107_T	0.536	0.96
49_Y	57_L	0.533	0.96
103_L	137_V	0.532	0.96
8_G	85_L	0.525	0.95
14_S	38_N	0.524	0.95
99_G	167_T	0.524	0.95
126_S	134_L	0.524	0.95
27_L	32_V	0.522	0.95
101_V	172_L	0.520	0.95
74_T	85_L	0.518	0.95
93_P	96_A	0.515	0.95
4_I	64_L	0.515	0.95
17_S	40_Q	0.514	0.95
159_T	166_E	0.512	0.95
170_Q	173_H	0.510	0.95
6_L	60_F	0.510	0.95
31_D	173_H	0.508	0.94
46_D	51_R	0.507	0.94
48_L	53_D	0.506	0.94
47_L	51_R	0.504	0.94
147_Y	153_F	0.502	0.94
146_D	150_R	0.501	0.94
85_L	121_L	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fzvA	5	0.9895	100	0.348	Contact Map
2q62A	4	0.9843	100	0.378	Contact Map
3u7rA	4	0.9215	100	0.394	Contact Map
3svlA	4	0.9058	100	0.394	Contact Map
4ptzC	4	0.911	100	0.401	Contact Map
1rttA	1	0.8848	100	0.416	Contact Map
4hs4A	6	0.9162	100	0.419	Contact Map
3fvwA	1	0.8953	100	0.426	Contact Map
4ltnA	4	0.9634	100	0.433	Contact Map
3k1yA	4	0.8953	100	0.446	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.