MAA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MAA - Maltose O-acetyltransferase

UniProt:	P77791	Sequences: MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTLRQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAPGVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDVPDNVVVGGNPARIIKKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14239
Length:	183 (156)
Sequences:	6211 (4426)
Seq/√Len:	354.4

ECOLI - MAA THGA WCAF WBBJ WCAB YRDA CAIE GLMU PAAY CYSE YAIX LPXD
BACSU - MAA YVOF EPSM DAPH CYSE YTOA GLMU
HALSA - Q9HNN1 Q9HQ06 Q9HPT3
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
88_M	94_I	4.230	1.00
85_D	105_G	3.153	1.00
75_F	95_R	3.034	1.00
108_I	130_V	2.996	1.00
134_N	152_D	2.883	1.00
79_N	99_N	2.792	1.00
133_G	152_D	2.652	1.00
78_N	98_D	2.632	1.00
135_N	153_N	2.445	1.00
145_N	158_S	2.189	1.00
77_G	98_D	2.178	1.00
109_Y	140_G	2.156	1.00
131_T	149_T	2.147	1.00
24_D	72_Y	2.118	1.00
110_T	129_P	2.026	1.00
56_Q	75_F	2.025	1.00
42_E	45_L	1.970	1.00
33_H	37_H	1.942	1.00
138_I	144_I	1.858	1.00
28_A	31_L	1.854	1.00
47_Q	51_A	1.816	1.00
58_T	78_N	1.782	1.00
76_L	80_F	1.777	1.00
33_H	40_A	1.749	1.00
133_G	149_T	1.743	1.00
75_F	93_P	1.680	1.00
108_I	111_A	1.661	1.00
111_A	127_G	1.646	1.00
80_F	100_C	1.636	1.00
63_E	81_F	1.594	1.00
80_F	98_D	1.527	1.00
82_A	86_C	1.469	1.00
92_C	127_G	1.463	1.00
37_H	58_T	1.448	1.00
57_V	60_A	1.429	1.00
95_R	131_T	1.411	1.00
45_L	48_Q	1.388	1.00
73_N	93_P	1.383	1.00
108_I	132_I	1.373	1.00
96_I	102_L	1.371	1.00
102_L	108_I	1.368	1.00
97_G	115_I	1.356	1.00
74_I	88_M	1.342	1.00
99_N	135_N	1.338	1.00
34_R	39_L	1.303	1.00
115_I	155_V	1.287	1.00
138_I	142_A	1.285	1.00
56_Q	76_L	1.282	1.00
31_L	52_D	1.272	1.00
30_Q	41_E	1.261	1.00
28_A	53_L	1.243	1.00
82_A	88_M	1.240	1.00
142_A	160_A	1.237	1.00
143_V	158_S	1.232	1.00
56_Q	59_E	1.217	1.00
116_D	119_A	1.214	1.00
71_G	74_I	1.211	1.00
132_I	138_I	1.200	1.00
76_L	96_I	1.185	1.00
130_V	148_V	1.177	1.00
97_G	134_N	1.170	1.00
60_A	76_L	1.150	1.00
77_G	97_G	1.145	1.00
132_I	136_V	1.143	1.00
27_R	31_L	1.142	1.00
87_V	105_G	1.130	1.00
145_N	163_T	1.096	1.00
49_I	53_L	1.095	1.00
150_I	154_V	1.092	1.00
83_N	101_M	1.088	1.00
98_D	134_N	1.084	1.00
98_D	115_I	1.072	1.00
121_N	135_N	1.050	1.00
50_L	54_F	1.047	1.00
19_E	23_R	1.043	1.00
95_R	112_T	1.039	1.00
120_R	137_W	1.017	1.00
20_T	24_D	1.006	1.00
107_H	141_R	0.998	1.00
99_N	116_D	0.997	1.00
102_L	138_I	0.993	1.00
136_V	154_V	0.985	1.00
13_L	126_L	0.983	1.00
76_L	82_A	0.977	1.00
48_Q	52_D	0.976	1.00
107_H	140_G	0.973	1.00
116_D	135_N	0.969	1.00
136_V	152_D	0.967	1.00
28_A	32_I	0.959	1.00
89_L	109_Y	0.940	1.00
112_T	131_T	0.936	1.00
37_H	40_A	0.929	1.00
59_E	78_N	0.928	1.00
115_I	134_N	0.923	1.00
133_G	154_V	0.923	1.00
81_F	101_M	0.923	1.00
117_P	152_D	0.904	1.00
6_E	10_A	0.900	1.00
96_I	100_C	0.892	1.00
157_A	160_A	0.886	1.00
30_Q	39_L	0.884	1.00
135_N	152_D	0.883	1.00
34_R	38_S	0.881	1.00
33_H	39_L	0.877	1.00
51_A	57_V	0.870	1.00
6_E	13_L	0.868	1.00
96_I	108_I	0.865	1.00
49_I	52_D	0.855	1.00
77_G	80_F	0.853	1.00
31_L	53_L	0.853	1.00
39_L	58_T	0.842	1.00
114_P	134_N	0.838	1.00
82_A	102_L	0.836	1.00
68_C	74_I	0.833	1.00
83_N	89_L	0.831	1.00
132_I	144_I	0.825	1.00
77_G	115_I	0.816	1.00
155_V	158_S	0.812	1.00
100_C	152_D	0.804	1.00
34_R	45_L	0.799	1.00
34_R	52_D	0.796	1.00
136_V	151_G	0.788	1.00
150_I	156_V	0.785	1.00
112_T	128_K	0.784	1.00
108_I	144_I	0.774	1.00
107_H	143_V	0.770	1.00
112_T	126_L	0.766	1.00
97_G	100_C	0.761	1.00
117_P	136_V	0.745	1.00
35_Y	50_L	0.743	1.00
52_D	55_G	0.743	1.00
80_F	134_N	0.741	1.00
62_I	82_A	0.735	1.00
38_S	45_L	0.735	1.00
67_R	84_F	0.734	1.00
60_A	80_F	0.732	1.00
96_I	132_I	0.731	1.00
105_G	141_R	0.721	0.99
109_Y	128_K	0.718	0.99
74_I	94_I	0.711	0.99
142_A	156_V	0.709	0.99
35_Y	38_S	0.708	0.99
102_L	106_V	0.702	0.99
142_A	158_S	0.696	0.99
67_R	85_D	0.684	0.99
57_V	78_N	0.680	0.99
126_L	141_R	0.679	0.99
80_F	96_I	0.674	0.99
13_L	124_A	0.669	0.99
133_G	151_G	0.668	0.99
80_F	97_G	0.668	0.99
71_G	89_L	0.667	0.99
144_I	150_I	0.665	0.99
55_G	75_F	0.664	0.99
12_E	15_R	0.664	0.99
22_S	25_R	0.659	0.99
89_L	107_H	0.658	0.99
118_V	137_W	0.654	0.99
46_R	53_L	0.650	0.99
124_A	141_R	0.644	0.99
46_R	64_P	0.642	0.99
45_L	49_I	0.642	0.99
44_T	48_Q	0.641	0.99
50_L	53_L	0.637	0.99
130_V	147_G	0.637	0.99
20_T	23_R	0.636	0.99
31_L	49_I	0.636	0.99
140_G	143_V	0.633	0.99
127_G	130_V	0.629	0.99
149_T	152_D	0.627	0.99
80_F	115_I	0.625	0.98
35_Y	64_P	0.620	0.98
114_P	131_T	0.618	0.98
39_L	42_E	0.617	0.98
26_L	29_R	0.616	0.98
106_V	142_A	0.615	0.98
38_S	61_Y	0.612	0.98
34_R	37_H	0.611	0.98
113_H	119_A	0.609	0.98
38_S	49_I	0.605	0.98
137_W	155_V	0.603	0.98
155_V	159_G	0.599	0.98
144_I	148_V	0.596	0.98
66_F	74_I	0.596	0.98
112_T	115_I	0.595	0.98
113_H	117_P	0.595	0.98
29_R	63_E	0.594	0.98
77_G	100_C	0.585	0.98
87_V	107_H	0.580	0.98
160_A	163_T	0.580	0.98
47_Q	50_L	0.578	0.97
108_I	113_H	0.576	0.97
87_V	104_P	0.575	0.97
155_V	160_A	0.574	0.97
138_I	150_I	0.572	0.97
106_V	138_I	0.572	0.97
26_L	31_L	0.572	0.97
35_Y	44_T	0.571	0.97
101_M	118_V	0.570	0.97
70_Y	74_I	0.566	0.97
100_C	134_N	0.566	0.97
23_R	26_L	0.565	0.97
119_A	124_A	0.562	0.97
32_I	68_C	0.562	0.97
43_H	47_Q	0.560	0.97
21_L	25_R	0.560	0.97
48_Q	66_F	0.559	0.97
24_D	27_R	0.554	0.97
117_P	120_R	0.552	0.97
129_P	147_G	0.546	0.96
18_D	22_S	0.544	0.96
105_G	124_A	0.543	0.96
157_A	163_T	0.542	0.96
84_F	87_V	0.539	0.96
86_C	106_V	0.537	0.96
127_G	132_I	0.535	0.96
93_P	110_T	0.530	0.96
55_G	62_I	0.525	0.96
18_D	21_L	0.523	0.95
85_D	107_H	0.521	0.95
63_E	84_F	0.519	0.95
107_H	120_R	0.519	0.95
69_D	85_D	0.518	0.95
9_I	92_C	0.517	0.95
27_R	52_D	0.516	0.95
27_R	30_Q	0.515	0.95
86_C	105_G	0.513	0.95
31_L	34_R	0.512	0.95
99_N	115_I	0.512	0.95
30_Q	34_R	0.511	0.95
93_P	129_P	0.507	0.95
14_Y	111_A	0.505	0.95
46_R	54_F	0.504	0.95
71_G	94_I	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hjjA	3	1	100	0.209	Contact Map
2p2oA	3	0.9945	100	0.211	Contact Map
3srtA	3	0.9945	100	0.215	Contact Map
3nz2A	4	0.9891	100	0.226	Contact Map
3fttA	3	0.9945	100	0.227	Contact Map
1krrA	3	1	100	0.234	Contact Map
1ocxA	3	0.9945	100	0.241	Contact Map
4g3qA	3	0.9781	99.9	0.452	Contact Map
2v0hA	3	0.9781	99.9	0.457	Contact Map
3vbiA	3	0.776	99.9	0.476	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.