SUFA - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SUFA - Protein SufA

UniProt:	P77667	Sequences: MDMHSGTFNPQDFAWQGLTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESFGV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG11378
Length:	122 (105)
Sequences:	3691 (1875)
Seq/√Len:	182.9

ECOLI - SUFA ISCA ERPA
BACSU - SUFA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_E	106_H	4.478	1.00
27_H	30_E	3.589	1.00
40_G	78_F	3.079	1.00
25_A	73_D	3.016	1.00
80_P	83_A	2.964	1.00
44_G	56_V	2.788	1.00
19_T	91_E	2.706	1.00
110_A	113_E	2.621	1.00
22_P	73_D	2.438	1.00
71_E	76_K	2.408	1.00
69_L	76_K	2.340	1.00
18_L	92_V	2.269	1.00
46_K	56_V	2.154	1.00
37_G	61_S	2.145	1.00
42_R	67_D	2.129	1.00
63_P	78_F	2.070	1.00
21_T	93_D	1.956	1.00
90_T	105_F	1.815	1.00
96_R	101_Q	1.697	1.00
71_E	74_G	1.656	1.00
29_R	74_G	1.649	1.00
29_R	33_A	1.547	1.00
40_G	76_K	1.484	1.00
53_F	86_F	1.403	1.00
63_P	69_L	1.345	1.00
22_P	72_H	1.324	1.00
48_T	98_G	1.318	1.00
60_V	64_D	1.316	1.00
23_A	93_D	1.313	1.00
95_V	104_K	1.206	1.00
22_P	26_I	1.203	1.00
26_I	29_R	1.184	1.00
43_L	87_I	1.179	1.00
28_I	41_V	1.173	1.00
68_L	81_L	1.159	1.00
20_L	28_I	1.134	1.00
112_N	121_G	1.127	1.00
85_P	88_D	1.119	1.00
60_V	63_P	1.106	1.00
35_Q	39_V	1.081	1.00
27_H	103_F	1.081	1.00
17_G	88_D	1.071	1.00
90_T	118_E	1.038	1.00
82_Q	85_P	1.038	1.00
32_V	38_M	1.038	1.00
97_E	104_K	1.016	0.99
25_A	75_A	1.013	0.99
47_Q	51_A	0.926	0.99
81_L	85_P	0.923	0.99
89_G	108_P	0.922	0.99
27_H	31_L	0.915	0.99
70_F	84_M	0.912	0.99
23_A	26_I	0.909	0.99
95_V	100_N	0.907	0.99
63_P	76_K	0.900	0.99
24_A	115_G	0.897	0.99
33_A	36_P	0.889	0.99
97_E	102_I	0.859	0.98
51_A	121_G	0.859	0.98
39_V	63_P	0.858	0.98
43_L	92_V	0.839	0.98
83_A	92_V	0.834	0.98
48_T	54_G	0.829	0.98
25_A	72_H	0.828	0.98
20_L	77_L	0.827	0.98
26_I	73_D	0.822	0.98
41_V	103_F	0.817	0.98
111_Q	121_G	0.815	0.98
35_Q	61_S	0.787	0.97
20_L	103_F	0.781	0.97
48_T	110_A	0.778	0.97
27_H	94_F	0.775	0.97
29_R	73_D	0.770	0.97
27_H	99_L	0.768	0.96
87_I	109_K	0.760	0.96
29_R	75_A	0.758	0.96
97_E	100_N	0.754	0.96
40_G	63_P	0.750	0.96
84_M	88_D	0.744	0.96
32_V	39_V	0.740	0.96
20_L	25_A	0.738	0.96
28_I	75_A	0.733	0.95
95_V	102_I	0.729	0.95
89_G	109_K	0.728	0.95
17_G	84_M	0.719	0.95
32_V	40_G	0.713	0.95
51_A	120_F	0.711	0.95
24_A	100_N	0.709	0.95
53_F	57_L	0.707	0.94
44_G	58_D	0.705	0.94
97_E	101_Q	0.697	0.94
20_L	72_H	0.696	0.94
32_V	59_S	0.695	0.94
47_Q	53_F	0.692	0.94
116_C	119_S	0.688	0.94
25_A	74_G	0.685	0.93
31_L	103_F	0.684	0.93
51_A	112_N	0.680	0.93
57_L	86_F	0.675	0.93
45_V	120_F	0.671	0.93
26_I	33_A	0.668	0.93
42_R	60_V	0.667	0.93
64_D	67_D	0.663	0.92
107_N	110_A	0.663	0.92
28_I	103_F	0.655	0.92
53_F	120_F	0.647	0.91
39_V	61_S	0.645	0.91
18_L	89_G	0.635	0.91
24_A	111_Q	0.635	0.91
45_V	48_T	0.633	0.91
68_L	88_D	0.629	0.90
68_L	84_M	0.629	0.90
38_M	59_S	0.626	0.90
69_L	78_F	0.626	0.90
72_H	77_L	0.617	0.89
96_R	115_G	0.613	0.89
27_H	96_R	0.611	0.89
33_A	64_D	0.609	0.89
117_G	120_F	0.604	0.88
33_A	37_G	0.601	0.88
60_V	67_D	0.598	0.88
95_V	99_L	0.593	0.87
22_P	25_A	0.592	0.87
40_G	69_L	0.588	0.87
110_A	120_F	0.588	0.87
66_D	81_L	0.588	0.87
94_F	101_Q	0.581	0.86
28_I	32_V	0.581	0.86
18_L	90_T	0.580	0.86
34_K	39_V	0.579	0.86
48_T	51_A	0.575	0.86
20_L	92_V	0.564	0.85
51_A	86_F	0.564	0.85
47_Q	82_Q	0.561	0.84
105_F	118_E	0.558	0.84
64_D	81_L	0.553	0.84
114_C	119_S	0.551	0.83
38_M	61_S	0.550	0.83
18_L	102_I	0.549	0.83
84_M	104_K	0.548	0.83
54_G	105_F	0.545	0.83
116_C	120_F	0.545	0.83
35_Q	38_M	0.544	0.83
31_L	59_S	0.531	0.81
29_R	32_V	0.529	0.81
36_P	61_S	0.529	0.81
88_D	109_K	0.527	0.81
68_L	85_P	0.526	0.80
47_Q	57_L	0.525	0.80
82_Q	86_F	0.523	0.80
17_G	72_H	0.521	0.80
57_L	100_N	0.516	0.79
75_A	90_T	0.510	0.78
21_T	99_L	0.507	0.78
53_F	115_G	0.505	0.78
57_L	90_T	0.505	0.78
65_K	81_L	0.504	0.78
25_A	29_R	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d2aA	2	0.9672	100	0.144	Contact Map
1nwbA	1	0.8197	100	0.194	Contact Map
1r94A	3	0.7951	100	0.195	Contact Map
1x0gA	4	0.8689	100	0.199	Contact Map
2apnA	1	0.9262	100	0.21	Contact Map
2k4zA	1	0.9672	100	0.364	Contact Map
2p2eA	1	0.8443	99.9	0.483	Contact Map
2qgoA	1	0.7377	99.8	0.5	Contact Map
2qrjA	1	0.9016	21.5	0.928	Contact Map
5aunA	1	0.623	15.1	0.932	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.