YQAB - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQAB - Fructose-1-phosphate phosphatase YqaB

UniProt:	P77475	Sequences: MYERYAGLIFDMDGTILDTEPTHRKAWREVLGHYGLQYDIQAMIALNGSPTWRIAQAIIELNQADLDPHALAREKTEAVRSMLLDSVEPLPLVDVVKSWHGRRPMAVGTGSESAIAEALLAHLGLRHYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGMDAVDVRLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13530
Length:	188 (181)
Sequences:	25385 (19765)
Seq/√Len:	1469.1

ECOLI - YQAB YIEH YNIC PGMB GPH YRFG YIGB YFBT YJJG YIHX
BACSU - YHCW YSAA PGMB PPAX YFNB
HALSA - Q9HP74 Q9HQE2 Q9HSS2 Q9HMC4
SULSO - Q7LXL6 Q97ZU6 Q97YZ1 Q97X58 Q97WT6 Q7LX46

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_A	161_Q	3.881	1.00
121_A	126_R	3.084	1.00
140_H	144_A	2.880	1.00
150_L	154_R	2.834	1.00
113_S	117_E	2.660	1.00
175_A	182_A	2.467	1.00
7_G	157_V	2.398	1.00
5_Y	181_D	2.370	1.00
166_E	171_G	2.323	1.00
97_K	128_Y	2.321	1.00
104_P	130_D	2.296	1.00
106_A	131_A	2.228	1.00
113_S	137_H	2.217	1.00
150_L	153_Q	2.184	1.00
140_H	146_D	2.173	1.00
33_H	74_E	2.143	1.00
108_G	147_T	2.127	1.00
131_A	154_R	2.115	1.00
10_F	105_M	2.087	1.00
152_A	162_C	2.006	1.00
173_Q	177_A	1.995	1.00
109_T	116_A	1.976	1.00
172_I	182_A	1.966	1.00
8_L	103_R	1.891	1.00
29_E	78_A	1.869	1.00
158_Q	161_Q	1.846	1.00
164_V	175_A	1.835	1.00
98_S	102_R	1.778	1.00
100_H	128_Y	1.765	1.00
39_D	42_A	1.737	1.00
152_A	180_M	1.736	1.00
117_E	126_R	1.679	1.00
163_V	183_V	1.626	1.00
100_H	130_D	1.623	1.00
7_G	155_M	1.588	1.00
9_I	108_G	1.587	1.00
152_A	159_P	1.516	1.00
34_Y	74_E	1.483	1.00
105_M	129_F	1.482	1.00
157_V	162_C	1.469	1.00
106_A	155_M	1.458	1.00
5_Y	163_V	1.442	1.00
9_I	151_C	1.441	1.00
9_I	164_V	1.427	1.00
78_A	81_S	1.409	1.00
15_T	165_F	1.404	1.00
8_L	165_F	1.377	1.00
16_I	93_V	1.370	1.00
169_D	173_Q	1.367	1.00
8_L	99_W	1.356	1.00
53_R	56_Q	1.348	1.00
33_H	78_A	1.291	1.00
29_E	33_H	1.288	1.00
12_M	116_A	1.286	1.00
25_K	82_M	1.268	1.00
133_V	154_R	1.260	1.00
12_M	17_L	1.250	1.00
133_V	151_C	1.246	1.00
145_P	149_L	1.226	1.00
12_M	107_V	1.222	1.00
29_E	82_M	1.209	1.00
98_S	101_G	1.204	1.00
117_E	121_A	1.198	1.00
74_E	77_E	1.197	1.00
70_A	74_E	1.178	1.00
67_D	70_A	1.168	1.00
148_F	164_V	1.165	1.00
89_P	125_L	1.153	1.00
148_F	174_A	1.146	1.00
74_E	78_A	1.120	1.00
176_R	182_A	1.110	1.00
25_K	29_E	1.104	1.00
84_L	118_A	1.104	1.00
7_G	162_C	1.102	1.00
9_I	162_C	1.102	1.00
118_A	122_H	1.078	1.00
146_D	150_L	1.078	1.00
30_V	34_Y	1.076	1.00
151_C	155_M	1.075	1.00
100_H	105_M	1.072	1.00
148_F	180_M	1.068	1.00
7_G	104_P	1.067	1.00
13_D	19_T	1.058	1.00
116_A	134_A	1.058	1.00
52_W	56_Q	1.057	1.00
113_S	134_A	1.056	1.00
124_G	127_H	1.053	1.00
149_L	153_Q	1.043	1.00
28_R	32_G	1.038	1.00
78_A	82_M	1.023	1.00
73_R	77_E	1.012	1.00
42_A	45_A	1.012	1.00
149_L	178_A	1.005	1.00
162_C	180_M	0.998	1.00
164_V	180_M	0.993	1.00
29_E	32_G	0.990	1.00
131_A	155_M	0.987	1.00
107_V	129_F	0.987	1.00
53_R	57_A	0.979	1.00
108_G	151_C	0.975	1.00
96_V	129_F	0.972	1.00
56_Q	68_P	0.965	1.00
25_K	28_R	0.965	1.00
25_K	86_S	0.958	1.00
72_A	76_T	0.955	1.00
12_M	111_S	0.954	1.00
97_K	101_G	0.952	1.00
172_I	184_D	0.944	1.00
57_A	60_E	0.942	1.00
56_Q	60_E	0.935	1.00
118_A	121_A	0.931	1.00
170_F	173_Q	0.925	1.00
77_E	81_S	0.920	1.00
31_L	36_L	0.918	1.00
49_S	57_A	0.914	1.00
9_I	155_M	0.913	1.00
90_L	93_V	0.903	1.00
28_R	40_I	0.898	1.00
146_D	149_L	0.897	1.00
148_F	166_E	0.890	1.00
6_A	103_R	0.880	1.00
7_G	106_A	0.876	1.00
149_L	159_P	0.871	1.00
75_K	79_V	0.859	1.00
109_T	134_A	0.858	1.00
94_D	97_K	0.857	1.00
138_V	150_L	0.854	1.00
113_S	136_D	0.854	1.00
24_R	43_M	0.852	1.00
106_A	151_C	0.852	1.00
40_I	44_I	0.848	1.00
99_W	103_R	0.837	1.00
82_M	85_D	0.836	1.00
17_L	123_L	0.835	1.00
13_D	111_S	0.832	1.00
163_V	181_D	0.828	1.00
133_V	150_L	0.825	1.00
159_P	180_M	0.824	1.00
134_A	137_H	0.813	1.00
174_A	178_A	0.810	1.00
99_W	105_M	0.807	1.00
165_F	183_V	0.806	1.00
24_R	28_R	0.806	1.00
55_A	59_I	0.799	1.00
69_H	73_R	0.798	1.00
157_V	161_Q	0.796	1.00
116_A	119_L	0.796	1.00
12_M	119_L	0.793	1.00
139_K	146_D	0.791	1.00
97_K	127_H	0.789	1.00
9_I	180_M	0.788	1.00
96_V	128_Y	0.781	1.00
117_E	132_V	0.780	1.00
105_M	128_Y	0.774	1.00
120_L	126_R	0.773	1.00
17_L	119_L	0.769	1.00
116_A	132_V	0.766	1.00
21_P	88_E	0.765	1.00
64_A	67_D	0.762	1.00
49_S	53_R	0.758	1.00
38_Y	43_M	0.740	1.00
148_F	171_G	0.732	1.00
5_Y	103_R	0.729	1.00
26_A	78_A	0.727	1.00
104_P	157_V	0.726	1.00
89_P	123_L	0.717	1.00
131_A	151_C	0.716	1.00
13_D	109_T	0.714	1.00
41_Q	44_I	0.710	1.00
94_D	98_S	0.703	1.00
145_P	177_A	0.700	1.00
90_L	185_V	0.697	1.00
82_M	86_S	0.694	1.00
111_S	116_A	0.689	1.00
57_A	61_L	0.688	1.00
6_A	104_P	0.687	1.00
38_Y	42_A	0.685	1.00
114_A	118_A	0.684	1.00
137_H	154_R	0.681	1.00
14_G	20_E	0.671	1.00
24_R	40_I	0.670	1.00
8_L	163_V	0.669	1.00
105_M	130_D	0.668	1.00
22_T	87_V	0.666	1.00
15_T	185_V	0.666	1.00
44_I	47_N	0.664	1.00
17_L	87_V	0.663	1.00
95_V	165_F	0.662	1.00
138_V	147_T	0.657	1.00
5_Y	161_Q	0.653	1.00
80_R	114_A	0.653	1.00
45_A	57_A	0.652	1.00
159_P	162_C	0.650	1.00
9_I	106_A	0.648	1.00
6_A	157_V	0.648	1.00
164_V	174_A	0.644	1.00
50_P	53_R	0.641	1.00
169_D	184_D	0.640	1.00
26_A	30_V	0.635	1.00
30_V	74_E	0.632	1.00
23_H	75_K	0.628	1.00
147_T	151_C	0.623	1.00
110_G	141_H	0.622	1.00
23_H	27_W	0.621	1.00
76_T	80_R	0.615	1.00
93_V	96_V	0.614	1.00
73_R	76_T	0.614	1.00
92_L	95_V	0.608	1.00
100_H	127_H	0.605	1.00
15_T	171_G	0.605	1.00
32_G	37_Q	0.604	1.00
173_Q	176_R	0.603	1.00
34_Y	70_A	0.603	1.00
111_S	115_I	0.599	1.00
95_V	98_S	0.599	1.00
116_A	120_L	0.597	1.00
60_E	63_Q	0.597	1.00
10_F	95_V	0.595	1.00
80_R	118_A	0.594	1.00
181_D	184_D	0.594	1.00
18_D	88_E	0.586	1.00
97_K	100_H	0.585	1.00
42_A	61_L	0.579	1.00
18_D	21_P	0.578	1.00
54_I	57_A	0.576	1.00
108_G	164_V	0.576	1.00
152_A	157_V	0.575	1.00
23_H	111_S	0.574	1.00
84_L	122_H	0.574	1.00
52_W	69_H	0.573	1.00
75_K	78_A	0.570	1.00
18_D	90_L	0.570	1.00
41_Q	45_A	0.570	1.00
66_L	70_A	0.569	1.00
147_T	174_A	0.566	1.00
13_D	119_L	0.565	1.00
148_F	175_A	0.560	1.00
52_W	72_A	0.560	1.00
70_A	73_R	0.559	1.00
63_Q	66_L	0.559	1.00
55_A	58_I	0.554	1.00
152_A	178_A	0.554	1.00
51_T	54_I	0.553	1.00
110_G	170_F	0.552	1.00
133_V	147_T	0.552	1.00
13_D	167_D	0.552	1.00
149_L	152_A	0.548	1.00
170_F	174_A	0.547	1.00
21_P	25_K	0.546	1.00
135_A	147_T	0.544	1.00
164_V	171_G	0.542	1.00
152_A	158_Q	0.538	1.00
121_A	127_H	0.535	1.00
107_V	120_L	0.532	1.00
133_V	155_M	0.529	1.00
8_L	105_M	0.529	1.00
108_G	133_V	0.526	1.00
112_E	115_I	0.526	1.00
22_T	25_K	0.523	1.00
33_H	77_E	0.520	1.00
59_I	64_A	0.519	1.00
77_E	80_R	0.518	1.00
15_T	184_D	0.517	1.00
71_L	74_E	0.516	1.00
174_A	177_A	0.515	1.00
120_L	125_L	0.513	1.00
95_V	99_W	0.511	1.00
5_Y	8_L	0.511	1.00
16_I	107_V	0.506	1.00
28_R	38_Y	0.503	1.00
176_R	181_D	0.502	1.00
111_S	166_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4uw9A	1	0.9362	100	0.281	Contact Map
3nasA	2	0.9202	100	0.301	Contact Map
3iruA	4	1	100	0.305	Contact Map
3l5kA	1	0.9947	100	0.31	Contact Map
1te2A	2	0.984	100	0.311	Contact Map
3sd7A	1	0.984	100	0.316	Contact Map
3kbbA	1	0.9787	100	0.317	Contact Map
1swvA	2	0.984	100	0.317	Contact Map
3e58A	2	0.984	100	0.322	Contact Map
3s6jA	2	0.9787	100	0.323	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.