HYFH - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HYFH - Hydrogenase-4 component H

UniProt:	P77423	Sequences: MLKLLKTIMRAGTATVKYPFAPLEVSPGFRGKPDLMPSQCIACGACACACPANALTIQTDDQQNSRTWQLYLGRCIYCGRCEEVCPTRAIQLTNNFELTVTNKADLYTRATFHLQRCSRCERPFAPQKTIALAAELLAQQQNAPQNREMLWAQASVCPECKQRATLINDDTDVLLVAKEQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG14216
Length:	181 (149)
Sequences:	540 (370)
Seq/√Len:	30.3

ECOLI - HYFH HYCF NUOI
HALSA - Q9HRL7
SULSO - Q980H1 Q97XY1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_E	90_I	4.791	1.00
157_C	160_C	3.281	1.00
39_Q	89_A	3.274	1.00
117_C	120_C	3.121	1.00
131_A	138_A	2.952	1.00
47_A	55_L	2.946	1.00
35_L	90_I	2.686	1.00
150_L	153_Q	2.067	0.98
113_H	127_Q	2.063	0.98
27_P	94_N	1.968	0.97
131_A	135_E	1.951	0.97
97_E	106_L	1.934	0.96
145_Q	148_E	1.893	0.96
147_R	150_L	1.878	0.96
41_I	87_T	1.876	0.96
54_A	76_I	1.835	0.95
34_D	93_T	1.790	0.95
134_A	138_A	1.751	0.94
82_E	92_L	1.741	0.94
120_C	124_F	1.668	0.92
117_C	137_L	1.612	0.91
120_C	137_L	1.570	0.90
132_L	140_Q	1.567	0.90
148_E	151_W	1.537	0.89
126_P	130_I	1.496	0.87
49_A	84_V	1.494	0.87
147_R	153_Q	1.457	0.86
138_A	151_W	1.430	0.85
49_A	80_R	1.413	0.84
148_E	155_S	1.344	0.81
84_V	89_A	1.331	0.80
25_V	96_F	1.331	0.80
130_I	134_A	1.315	0.79
135_E	139_Q	1.266	0.77
120_C	157_C	1.263	0.76
52_A	74_R	1.249	0.76
120_C	160_C	1.227	0.74
134_A	155_S	1.224	0.74
151_W	155_S	1.215	0.73
102_N	105_D	1.209	0.73
34_D	91_Q	1.202	0.73
133_A	137_L	1.201	0.73
159_E	162_Q	1.191	0.72
146_N	150_L	1.162	0.70
117_C	160_C	1.151	0.69
127_Q	134_A	1.148	0.69
57_I	68_W	1.120	0.67
146_N	149_M	1.119	0.67
118_S	152_A	1.118	0.67
43_C	85_C	1.116	0.67
46_C	85_C	1.116	0.67
78_C	81_C	1.116	0.67
46_C	50_C	1.116	0.67
46_C	78_C	1.116	0.67
46_C	81_C	1.116	0.67
81_C	85_C	1.116	0.67
40_C	43_C	1.116	0.67
50_C	78_C	1.116	0.67
50_C	81_C	1.116	0.67
50_C	85_C	1.116	0.67
78_C	85_C	1.116	0.67
43_C	81_C	1.116	0.67
43_C	78_C	1.116	0.67
40_C	81_C	1.116	0.67
40_C	78_C	1.116	0.67
40_C	85_C	1.116	0.67
40_C	50_C	1.116	0.67
40_C	46_C	1.116	0.67
43_C	46_C	1.116	0.67
43_C	50_C	1.116	0.67
149_M	152_A	1.112	0.67
27_P	96_F	1.110	0.66
50_C	75_C	1.098	0.66
43_C	75_C	1.098	0.66
75_C	81_C	1.098	0.66
40_C	75_C	1.098	0.66
75_C	85_C	1.098	0.66
46_C	75_C	1.098	0.66
75_C	78_C	1.098	0.66
49_A	128_K	1.093	0.65
117_C	157_C	1.077	0.64
67_T	111_T	1.069	0.64
157_C	161_K	1.066	0.63
36_M	39_Q	1.058	0.63
117_C	124_F	1.054	0.62
17_K	20_F	1.042	0.61
13_T	20_F	1.038	0.61
73_G	77_Y	1.027	0.60
42_A	77_Y	1.017	0.60
52_A	76_I	1.011	0.59
58_Q	67_T	1.004	0.59
117_C	121_E	0.987	0.57
15_T	30_R	0.983	0.57
150_L	156_V	0.982	0.57
35_L	93_T	0.982	0.57
147_R	154_A	0.975	0.56
134_A	139_Q	0.975	0.56
33_P	80_R	0.974	0.56
69_Q	88_R	0.965	0.56
148_E	153_Q	0.956	0.55
146_N	153_Q	0.954	0.55
152_A	155_S	0.950	0.54
147_R	151_W	0.933	0.53
31_G	36_M	0.926	0.52
63_Q	109_R	0.926	0.52
21_A	24_E	0.925	0.52
15_T	19_P	0.909	0.51
58_Q	63_Q	0.905	0.51
16_V	23_L	0.876	0.48
56_T	105_D	0.875	0.48
147_R	152_A	0.872	0.48
35_L	44_G	0.870	0.48
108_T	118_S	0.861	0.47
51_P	76_I	0.859	0.47
150_L	154_A	0.849	0.46
127_Q	138_A	0.844	0.46
51_P	86_P	0.841	0.46
129_T	138_A	0.831	0.45
89_A	92_L	0.828	0.45
122_R	137_L	0.825	0.44
77_Y	98_L	0.823	0.44
122_R	159_E	0.823	0.44
59_T	63_Q	0.817	0.44
96_F	106_L	0.808	0.43
123_P	127_Q	0.806	0.43
152_A	158_P	0.804	0.43
116_R	123_P	0.802	0.43
80_R	84_V	0.787	0.41
15_T	18_Y	0.787	0.41
156_V	161_K	0.785	0.41
114_L	117_C	0.783	0.41
33_P	83_E	0.775	0.40
82_E	97_E	0.774	0.40
52_A	70_L	0.773	0.40
52_A	89_A	0.770	0.40
39_Q	90_I	0.762	0.40
129_T	132_L	0.745	0.38
45_A	120_C	0.741	0.38
144_P	153_Q	0.740	0.38
77_Y	94_N	0.738	0.38
135_E	138_A	0.736	0.38
53_N	105_D	0.734	0.37
144_P	151_W	0.727	0.37
155_S	158_P	0.725	0.37
12_G	95_N	0.724	0.37
14_A	122_R	0.718	0.36
117_C	126_P	0.713	0.36
59_T	62_Q	0.711	0.36
89_A	98_L	0.709	0.36
69_Q	109_R	0.707	0.35
99_T	108_T	0.703	0.35
148_E	152_A	0.697	0.35
154_A	157_C	0.691	0.34
54_A	68_W	0.691	0.34
74_R	84_V	0.690	0.34
158_P	161_K	0.685	0.34
134_A	149_M	0.685	0.34
61_D	113_H	0.683	0.34
120_C	123_P	0.680	0.33
146_N	155_S	0.680	0.33
153_Q	156_V	0.678	0.33
51_P	103_K	0.676	0.33
131_A	134_A	0.673	0.33
95_N	105_D	0.662	0.32
32_K	93_T	0.661	0.32
31_G	54_A	0.657	0.32
125_A	129_T	0.654	0.32
16_V	21_A	0.653	0.32
156_V	160_C	0.652	0.31
36_M	54_A	0.650	0.31
76_I	80_R	0.643	0.31
80_R	90_I	0.638	0.31
13_T	16_V	0.635	0.30
134_A	140_Q	0.634	0.30
99_T	106_L	0.624	0.30
120_C	132_L	0.614	0.29
138_A	141_Q	0.613	0.29
79_G	92_L	0.604	0.28
45_A	49_A	0.604	0.28
71_Y	76_I	0.601	0.28
44_G	48_C	0.593	0.28
150_L	155_S	0.593	0.28
22_P	96_F	0.592	0.28
141_Q	154_A	0.578	0.27
138_A	150_L	0.578	0.27
28_G	45_A	0.576	0.27
32_K	95_N	0.575	0.26
37_P	89_A	0.572	0.26
137_L	141_Q	0.568	0.26
33_P	38_S	0.567	0.26
128_K	132_L	0.566	0.26
100_V	106_L	0.565	0.26
120_C	126_P	0.563	0.26
103_K	107_Y	0.563	0.26
18_Y	97_E	0.562	0.26
145_Q	155_S	0.560	0.26
73_G	96_F	0.554	0.25
45_A	80_R	0.552	0.25
92_L	120_C	0.546	0.25
70_L	130_I	0.545	0.25
20_F	47_A	0.536	0.24
29_F	83_E	0.534	0.24
13_T	59_T	0.525	0.23
52_A	87_T	0.521	0.23
119_R	126_P	0.521	0.23
144_P	149_M	0.519	0.23
76_I	84_V	0.518	0.23
18_Y	86_P	0.515	0.23
130_I	138_A	0.514	0.23
99_T	128_K	0.513	0.23
53_N	69_Q	0.513	0.23
131_A	136_L	0.513	0.23
123_P	132_L	0.513	0.23
139_Q	151_W	0.511	0.23
72_L	77_Y	0.509	0.23
135_E	140_Q	0.508	0.22
33_P	68_W	0.507	0.22
32_K	100_V	0.506	0.22
71_Y	107_Y	0.506	0.22
135_E	149_M	0.505	0.22
70_L	113_H	0.504	0.22
35_L	115_Q	0.503	0.22
76_I	92_L	0.501	0.22
96_F	127_Q	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i9v9	1	0.768	99.9	0.563	Contact Map
5c4iB	1	0.4696	99.6	0.689	Contact Map
1gteA	4	0.5525	99.6	0.69	Contact Map
4omfG	2	0.5249	99.5	0.706	Contact Map
1hfeL	2	0.8729	99.5	0.706	Contact Map
3i9v3	1	0.895	99.5	0.709	Contact Map
1xerA	2	0.5193	99.4	0.714	Contact Map
2gmhA	1	0.5856	99.4	0.715	Contact Map
1rgvA	1	0.4088	99.4	0.72	Contact Map
2c42A	2	0.8895	99.4	0.721	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.