YBCL - ECOLI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YBCL - UPF0098 protein YbcL

UniProt:	P77368	Sequences: MKTLIVSTVLAFITFSAQAAAFQVTSNEIKTGEQLTTSHVFSGFGCEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSGWWHWTVVNIPATVTYLPVDAGRRDGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWALKTEKIPVDSNSSGALVGYMLNANKIATAEITPVYEIK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
EcoGene:	EG13628
Length:	183 (151)
Sequences:	2574 (1765)
Seq/√Len:	143.7

ECOLI - YBCL YBHB
BACSU - YXKA
HALSA - Q9HND1
SULSO - Q7LXJ9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
147_K	169_N	4.998	1.00
60_V	67_F	3.847	1.00
46_C	129_C	3.309	1.00
120_F	126_G	2.846	1.00
71_V	141_F	2.741	1.00
38_S	99_V	2.734	1.00
69_V	143_V	2.643	1.00
22_F	174_A	2.510	1.00
34_Q	179_V	2.484	1.00
89_N	152_P	2.374	1.00
27_N	54_S	2.297	1.00
28_E	99_V	2.273	1.00
28_E	54_S	2.221	1.00
30_K	33_E	2.028	1.00
140_Q	177_T	1.906	1.00
29_I	178_P	1.877	1.00
142_K	175_E	1.837	1.00
68_A	162_V	1.826	1.00
67_F	92_A	1.776	1.00
35_L	128_A	1.738	1.00
24_V	143_V	1.702	1.00
38_S	49_G	1.684	1.00
50_N	127_G	1.683	1.00
146_L	166_L	1.582	1.00
88_V	116_G	1.581	1.00
60_V	95_T	1.565	1.00
116_G	162_V	1.563	1.00
52_S	97_L	1.524	1.00
54_S	96_Y	1.493	1.00
56_T	96_Y	1.477	1.00
136_P	181_E	1.466	1.00
135_K	181_E	1.446	1.00
110_P	113_A	1.445	1.00
87_V	113_A	1.412	1.00
89_N	150_K	1.400	1.00
68_A	166_L	1.388	1.00
26_S	176_I	1.386	1.00
75_D	138_H	1.382	1.00
90_I	94_V	1.375	1.00
24_V	174_A	1.347	1.00
142_K	173_T	1.337	1.00
57_W	97_L	1.306	1.00
162_V	166_L	1.298	1.00
66_S	148_T	1.297	1.00
88_V	162_V	1.286	1.00
35_L	178_P	1.274	1.00
73_D	84_H	1.274	1.00
29_I	36_T	1.259	1.00
83_W	159_G	1.216	1.00
34_Q	181_E	1.211	1.00
66_S	89_N	1.189	1.00
158_S	161_L	1.182	1.00
100_D	103_R	1.173	1.00
24_V	55_L	1.154	1.00
125_F	128_A	1.153	0.99
86_T	162_V	1.146	0.99
23_Q	58_S	1.144	0.99
148_T	169_N	1.144	0.99
86_T	116_G	1.142	0.99
82_W	120_F	1.139	0.99
165_M	168_A	1.133	0.99
166_L	170_K	1.132	0.99
38_S	51_T	1.130	0.99
27_N	56_T	1.125	0.99
144_W	166_L	1.110	0.99
89_N	114_V	1.097	0.99
66_S	150_K	1.090	0.99
26_S	55_L	1.090	0.99
61_P	64_T	1.076	0.99
115_Q	124_G	1.064	0.99
88_V	157_S	1.060	0.99
102_G	115_Q	1.053	0.99
140_Q	175_E	1.028	0.99
98_P	101_A	1.011	0.99
67_F	143_V	1.009	0.99
51_T	99_V	1.009	0.99
68_A	146_L	1.009	0.99
109_L	113_A	0.994	0.98
22_F	172_A	0.992	0.98
52_S	85_W	0.991	0.98
26_S	29_I	0.977	0.98
61_P	145_A	0.973	0.98
60_V	64_T	0.972	0.98
151_I	166_L	0.963	0.98
72_Y	80_S	0.962	0.98
144_W	170_K	0.958	0.98
72_Y	83_W	0.954	0.98
88_V	114_V	0.949	0.98
84_H	130_P	0.947	0.98
53_P	141_F	0.936	0.98
22_F	60_V	0.933	0.98
60_V	63_G	0.930	0.98
89_N	151_I	0.925	0.98
63_G	171_I	0.924	0.98
24_V	176_I	0.915	0.97
67_F	95_T	0.910	0.97
138_H	177_T	0.905	0.97
143_V	174_A	0.898	0.97
61_P	67_F	0.897	0.97
71_V	125_F	0.897	0.97
31_T	177_T	0.890	0.97
57_W	67_F	0.884	0.97
64_T	171_I	0.883	0.97
72_Y	142_K	0.881	0.97
29_I	33_E	0.878	0.97
25_T	56_T	0.871	0.97
64_T	67_F	0.870	0.97
157_S	162_V	0.869	0.96
84_H	137_H	0.847	0.96
50_N	120_F	0.846	0.96
85_W	115_Q	0.842	0.96
117_R	156_N	0.837	0.96
74_P	140_Q	0.836	0.96
73_D	137_H	0.810	0.95
130_P	137_H	0.805	0.95
34_Q	136_P	0.800	0.94
157_S	161_L	0.797	0.94
64_T	145_A	0.795	0.94
52_S	101_A	0.790	0.94
34_Q	37_T	0.789	0.94
80_S	160_A	0.786	0.94
32_G	177_T	0.783	0.94
29_I	176_I	0.776	0.94
85_W	102_G	0.775	0.93
147_K	170_K	0.764	0.93
58_S	95_T	0.763	0.93
161_L	165_M	0.751	0.92
79_G	163_G	0.748	0.92
73_D	130_P	0.745	0.92
63_G	172_A	0.741	0.92
82_W	126_G	0.734	0.91
50_N	126_G	0.733	0.91
154_D	157_S	0.725	0.91
51_T	100_D	0.723	0.91
86_T	159_G	0.722	0.91
37_T	47_E	0.715	0.90
55_L	141_F	0.703	0.90
32_G	179_V	0.700	0.89
33_E	179_V	0.698	0.89
87_V	115_Q	0.696	0.89
123_A	156_N	0.696	0.89
89_N	148_T	0.695	0.89
118_N	126_G	0.695	0.89
70_T	166_L	0.693	0.89
45_G	48_G	0.693	0.89
76_A	79_G	0.692	0.89
25_T	58_S	0.690	0.89
72_Y	159_G	0.689	0.89
170_K	173_T	0.673	0.88
100_D	108_K	0.672	0.87
76_A	82_W	0.665	0.87
55_L	176_I	0.663	0.87
132_K	136_P	0.657	0.86
48_G	129_C	0.657	0.86
46_C	126_G	0.657	0.86
161_L	164_Y	0.656	0.86
59_G	67_F	0.656	0.86
50_N	122_Y	0.639	0.85
167_N	173_T	0.633	0.84
159_G	163_G	0.631	0.84
116_G	159_G	0.628	0.84
166_L	169_N	0.627	0.84
145_A	171_I	0.626	0.84
118_N	122_Y	0.619	0.83
59_G	95_T	0.616	0.83
33_E	178_P	0.614	0.82
82_W	161_L	0.610	0.82
136_P	179_V	0.610	0.82
122_Y	126_G	0.607	0.82
76_A	81_G	0.607	0.82
87_V	90_I	0.605	0.81
55_L	69_V	0.602	0.81
153_V	162_V	0.600	0.81
117_R	121_G	0.597	0.81
47_E	180_Y	0.593	0.80
117_R	123_A	0.592	0.80
21_A	59_G	0.591	0.80
35_L	141_F	0.590	0.80
82_W	164_Y	0.590	0.80
72_Y	163_G	0.589	0.80
142_K	163_G	0.581	0.79
61_P	172_A	0.570	0.77
130_P	133_G	0.568	0.77
44_F	47_E	0.561	0.76
69_V	90_I	0.559	0.76
68_A	116_G	0.556	0.76
72_Y	140_Q	0.554	0.75
38_S	44_F	0.554	0.75
115_Q	123_A	0.547	0.75
72_Y	81_G	0.544	0.74
84_H	127_G	0.544	0.74
52_S	100_D	0.543	0.74
75_D	84_H	0.543	0.74
56_T	95_T	0.538	0.73
153_V	157_S	0.538	0.73
76_A	119_D	0.538	0.73
75_D	137_H	0.537	0.73
76_A	80_S	0.537	0.73
84_H	131_P	0.536	0.73
31_T	175_E	0.536	0.73
57_W	96_Y	0.536	0.73
83_W	119_D	0.534	0.73
146_L	170_K	0.534	0.73
57_W	172_A	0.534	0.73
60_V	172_A	0.534	0.73
147_K	171_I	0.534	0.73
97_L	101_A	0.528	0.72
37_T	49_G	0.527	0.72
87_V	102_G	0.526	0.72
66_S	169_N	0.525	0.72
73_D	76_A	0.523	0.71
146_L	171_I	0.522	0.71
67_F	145_A	0.522	0.71
87_V	109_L	0.519	0.71
57_W	143_V	0.516	0.70
45_G	180_Y	0.515	0.70
103_R	109_L	0.514	0.70
123_A	155_S	0.512	0.70
82_W	118_N	0.508	0.69
82_W	119_D	0.505	0.69
168_A	171_I	0.505	0.69
76_A	137_H	0.504	0.68
77_P	138_H	0.504	0.68
103_R	115_Q	0.504	0.68
22_F	59_G	0.500	0.68
68_A	144_W	0.500	0.68

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1fuxA	2	0.8962	100	0.184	Contact Map
4begA	4	0.9617	100	0.206	Contact Map
1fjjA	2	0.8689	100	0.209	Contact Map
3n08A	2	0.8142	100	0.235	Contact Map
2evvA	2	0.8415	100	0.297	Contact Map
1wpxB	1	0.8689	100	0.545	Contact Map
2jyzA	1	0.8142	99.9	0.579	Contact Map
1vw41	1	0.847	99.9	0.585	Contact Map
2gzqA	1	0.8525	99.9	0.586	Contact Map
3axyA	1	0.8033	99.9	0.597	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.